SecReT4
Protein ID: 148254777
T4SS name [ID]Trb [336]
Gene symbol-
Locus tagBBta_3356
StrainBradyrhizobium sp. BTAi1
Repliconchromosome [GenBank: NC_009485] [Browse all T4SS(s) in this replicon]
Location [Strand]3511046..3513046 [+]
Productconjugal transfer coupling protein TraG
Component typeTraG
UniProt IDA5EH12
KEGG IDbbt:BBta_3356
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 4.9e-101, Aligned region: 113..556
TraG-D_C [PF12696], Evalue: 7.1e-31, Aligned region: 402..523
TrwB_AAD_bind [PF10412], Evalue: 1.3e-29, Aligned region: 165..536
AAA_10 [PF12846], Evalue: 2.2e-06, Aligned region: 147..479
Protein Sequence: 666 a.a.     [Download]
>gi|148254777|ref|YP_001239362.1| conjugal transfer coupling protein TraG [Bradyrhizobium sp. BTAi1]
MPGTRILWGQITAVVTIVLVTMWAATQWTAWRLGYQPQLGQPWFELAWGMPIYFPPSFLWWWFAYDAYAP
EVFAEGGLIAAFGGVASIAVAFGMSVWRAREPADVVTYGSARWATLKEISAAGLQGPDGVVLGRYADQYL
RHDGPEHVLCFAPTRSGKGVGLVVPTLLTWSGSCIVHDIKGENWQLTAGFRAPHGRVLLFDPTNARSAAY
NPLLEVRRGEWEVRDVQNVADVLVDPEGSLERRNHWEKTSHALLVGAILHVLYAEADKTLAGVANFLSDP
KRPIDVTLRAMMTTAHLGDAGPHPVIASAARELLNKSENERSGVLSTAMSFLGLYRDPVVAQVTRRCDWR
IRDLVAGEHPTTLYLVVPPSDISRTKPLVRLILNQIGRRLTEDLQAHGRRHRLLLMLDEFPALGRLDFFE
SALAFMAGYGLKSFLIAQSLNQIEKAYGANNAILDNCHVRVSFATNDERTAKRVSDALGTATEMRAMKNY
AGHRLSPWLGHLMVSRQETARPLLTPGEVMQLPADDELVLVSGVPPIRGKKARYFADPRLVDRVLPPPNP
VLTDQDGDAAADDWSRLPPIARTIAAKEQGRPAALDAAGDAANAGIRREPELPEHEEIVPEPSRPAQEFN
FDREVDDEMVRNSVLRDQLRGLPRQAALDPDDGLGL
 
Nucleotide Sequence: 2001 bp     [Download]
>gi|148251626|ref|NC_009485.1|:3511046-3513046 Bradyrhizobium sp. BTAi1 chromosome, complete genome
ATGCCTGGCACGCGAATCCTCTGGGGGCAGATCACAGCGGTCGTCACGATCGTGCTTGTCACGATGTGGG
CCGCGACGCAGTGGACGGCGTGGCGGCTGGGGTATCAACCGCAGCTTGGGCAGCCCTGGTTCGAGCTGGC
GTGGGGTATGCCGATTTATTTCCCGCCTTCGTTTTTATGGTGGTGGTTTGCGTATGACGCCTATGCGCCC
GAGGTGTTCGCCGAGGGAGGTCTGATTGCGGCGTTCGGCGGTGTGGCCTCGATCGCGGTTGCGTTCGGCA
TGTCGGTGTGGCGGGCGCGTGAGCCCGCCGATGTCGTCACCTACGGGTCCGCGCGATGGGCGACGCTGAA
GGAGATCTCCGCTGCCGGGCTGCAGGGGCCGGACGGCGTGGTGCTGGGACGGTACGCGGATCAGTACCTT
CGTCATGACGGTCCGGAGCATGTGCTGTGTTTCGCGCCGACCCGCTCGGGCAAGGGCGTTGGCCTGGTAG
TGCCGACCCTGCTGACGTGGTCGGGTAGTTGCATCGTGCACGACATCAAGGGCGAGAACTGGCAACTGAC
GGCGGGCTTTCGAGCGCCGCATGGCCGGGTGCTGCTGTTCGATCCGACCAATGCGCGATCGGCGGCCTAC
AATCCGCTGCTCGAGGTGAGGCGAGGGGAGTGGGAGGTCCGCGACGTCCAGAATGTCGCCGACGTCCTGG
TCGATCCTGAAGGGTCGCTGGAGCGGCGCAATCATTGGGAGAAGACGAGCCACGCACTACTGGTCGGGGC
CATTCTCCATGTGCTTTACGCGGAAGCTGACAAGACGCTGGCGGGGGTCGCCAACTTCCTCTCCGATCCA
AAGCGGCCGATCGATGTCACTCTGCGCGCGATGATGACCACGGCGCATCTGGGGGACGCCGGGCCGCACC
CTGTGATCGCATCCGCCGCCCGCGAGCTCCTGAACAAGAGCGAAAACGAACGCTCGGGCGTGCTCTCGAC
CGCGATGTCGTTTCTCGGTTTGTATCGAGATCCGGTGGTAGCGCAGGTGACGCGCCGTTGCGACTGGCGG
ATCCGTGATCTCGTCGCTGGCGAGCATCCGACCACGCTCTATCTCGTGGTGCCGCCCTCCGACATCAGCC
GGACCAAGCCGCTGGTGCGGCTGATCCTCAACCAGATCGGCCGCCGACTGACCGAGGATCTGCAGGCCCA
CGGGCGGCGCCACCGGCTGCTTCTGATGCTCGACGAATTCCCGGCACTCGGCCGGCTCGACTTCTTCGAG
TCCGCGCTCGCCTTCATGGCTGGTTACGGCCTCAAGAGCTTCTTGATCGCGCAATCGCTCAATCAGATCG
AGAAGGCCTACGGGGCCAATAACGCCATCCTCGACAATTGTCATGTGCGGGTGTCGTTTGCGACCAATGA
CGAGCGTACCGCCAAGCGTGTGTCGGACGCGCTGGGGACCGCCACCGAGATGCGGGCGATGAAGAACTAT
GCCGGCCATCGACTGAGCCCTTGGCTGGGACATCTCATGGTGTCACGCCAGGAGACGGCGCGTCCCTTGC
TCACGCCGGGAGAGGTGATGCAGCTGCCGGCTGATGATGAGTTGGTGCTGGTCTCCGGTGTTCCGCCGAT
CCGCGGCAAGAAGGCCCGGTATTTCGCAGATCCGCGGCTGGTCGATCGGGTGTTGCCACCTCCCAATCCG
GTTTTGACGGATCAGGACGGCGACGCAGCAGCGGATGATTGGAGCAGGCTGCCGCCGATCGCTCGGACTA
TCGCAGCAAAAGAGCAGGGGAGGCCGGCTGCGCTGGATGCAGCCGGTGACGCCGCGAATGCCGGGATCCG
GAGGGAGCCCGAGCTTCCCGAGCATGAGGAGATCGTGCCGGAGCCGTCGCGGCCCGCGCAGGAGTTCAAC
TTTGACAGAGAAGTGGATGACGAGATGGTGCGCAACAGCGTGCTCCGTGACCAGCTTCGCGGCTTGCCGC
GCCAGGCGGCGCTGGACCCGGACGATGGCCTTGGTCTGTAG
 Primer design