SecReT4
Protein ID: 148254784
T4SS name [ID]Trb [336]
Gene symboltrbB
Locus tagBBta_3364
StrainBradyrhizobium sp. BTAi1
Repliconchromosome [GenBank: NC_009485] [Browse all T4SS(s) in this replicon]
Location [Strand]3521448..3522428 [+]
Productconjugal transfer protein TrbB
Component typeTrbB
UniProt IDA5EH19
KEGG IDbbt:BBta_3364
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 1e-83, Aligned region: 26..290
FtsK_SpoIIIE [PF01580], Evalue: 2.6e-05, Aligned region: 142..180
Protein Sequence: 326 a.a.     [Download]
>gi|148254784|ref|YP_001239369.1| conjugal transfer protein TrbB [Bradyrhizobium sp. BTAi1]
MAVHSWRTEASSRGARMLRTALGPAIAGWLDDPAVIEVMLNPDGRLWVDRLASGLTATGETLSPADGERI
VRLVAHHVGGEVHAGAPRVSAELPETGERFEGLLPPVVIAPAFAIRKPAVAVFTLADYVASGIVTREQAD
LLRIAMAARSNILVAGGTSTGKTTLTNALLAEVARTADRVVLIEDTRELQCAAPNLVSLRTRDGVATLTD
LVRSALRLRPDRIPIGEVRGPEALDLLKAWGTGHPGGIGTIHAGSAIGALRRLEQLIQEAVVTVPRALIA
ETIQLIAVLAGRGADRRLVELAHVDGLNARGDYQLSQLSLSQGEQP
 
Nucleotide Sequence: 981 bp     [Download]
>gi|148251626|ref|NC_009485.1|:3521448-3522428 Bradyrhizobium sp. BTAi1 chromosome, complete genome
ATGGCGGTTCATTCATGGCGGACCGAGGCGAGCTCGCGCGGCGCGCGGATGTTGCGCACGGCGCTGGGGC
CTGCCATCGCGGGCTGGCTCGATGATCCCGCTGTCATCGAGGTGATGCTCAACCCGGATGGCCGGCTCTG
GGTCGATCGTCTCGCTTCGGGTCTGACTGCAACGGGTGAGACGCTCTCGCCCGCCGATGGCGAGCGCATC
GTGCGTCTGGTCGCGCATCATGTCGGCGGCGAGGTTCATGCCGGTGCGCCGCGCGTCTCGGCCGAGCTGC
CGGAGACCGGTGAGCGCTTCGAAGGTCTGCTGCCGCCCGTCGTGATCGCGCCGGCCTTTGCCATCCGCAA
GCCCGCGGTCGCCGTGTTCACGCTCGCGGATTACGTCGCGTCCGGGATCGTTACGCGAGAGCAGGCCGAC
CTGTTGCGAATAGCTATGGCCGCGCGCAGCAACATCCTCGTCGCAGGGGGCACCTCGACCGGCAAGACCA
CGCTGACGAATGCGCTGTTGGCGGAAGTTGCAAGAACGGCCGATCGGGTGGTGCTGATCGAGGATACGCG
CGAGCTGCAATGCGCAGCGCCCAATCTGGTGTCGCTTCGGACCAGGGACGGTGTTGCCACCCTGACGGAC
CTCGTGCGGTCCGCGTTGCGGTTGCGACCCGATAGGATCCCGATCGGCGAAGTTCGCGGGCCCGAGGCTC
TGGATCTGCTGAAGGCTTGGGGCACCGGTCATCCCGGCGGCATCGGCACCATCCATGCGGGCTCCGCGAT
CGGCGCGCTCAGGCGCCTGGAGCAATTGATCCAGGAAGCCGTGGTCACCGTGCCGCGTGCTCTGATCGCC
GAGACCATCCAGCTGATCGCCGTGCTCGCCGGCCGCGGCGCAGACCGGCGCCTCGTCGAGCTCGCCCACG
TCGATGGGCTGAATGCCCGCGGCGACTATCAGCTTAGCCAGCTCTCGCTCTCGCAAGGAGAACAGCCATG
A
 Primer design