SecReT4
Protein ID: 148254786
T4SS name [ID]Trb [336]
Gene symboltrbD
Locus tagBBta_3366
StrainBradyrhizobium sp. BTAi1
Repliconchromosome [GenBank: NC_009485] [Browse all T4SS(s) in this replicon]
Location [Strand]3522754..3523035 [+]
Productconjugal transfer protein TrbD
Component typeTrbD
UniProt IDA5EH21
KEGG IDbbt:BBta_3366
PDB IDNA
Domain hit(s) vs Pfam VirB3 [PF05101], Evalue: 9.7e-10, Aligned region: 16..84
Protein Sequence: 93 a.a.     [Download]
>gi|148254786|ref|YP_001239371.1| conjugal transfer protein TrbD [Bradyrhizobium sp. BTAi1]
MDAFGQADQSLPGFAITVRRSLTEPILLGGAPRAIAILNGTLAAALGLGLRLWIAGLLFWVIGHGAAVWA
AKRDPDFVEVVRRHLRIPGHLNV
 
Nucleotide Sequence: 282 bp     [Download]
>gi|148251626|ref|NC_009485.1|:3522754-3523035 Bradyrhizobium sp. BTAi1 chromosome, complete genome
ATGGATGCGTTTGGCCAAGCCGATCAGTCGCTTCCCGGCTTCGCGATCACTGTCCGCCGCTCTCTGACCG
AGCCCATCCTGCTCGGCGGTGCGCCACGCGCCATCGCGATCCTCAACGGTACGCTCGCCGCGGCGCTTGG
CTTGGGGCTGCGGCTCTGGATTGCGGGGCTTCTGTTCTGGGTGATCGGCCATGGCGCGGCAGTGTGGGCC
GCCAAACGCGATCCGGACTTCGTCGAGGTCGTGCGCCGGCACCTGCGCATTCCCGGTCATCTCAATGTGT
GA
 Primer design