SecReT4
Protein ID: 148254787
T4SS name [ID]Trb [336]
Gene symboltrbE
Locus tagBBta_3367
StrainBradyrhizobium sp. BTAi1
Repliconchromosome [GenBank: NC_009485] [Browse all T4SS(s) in this replicon]
Location [Strand]3523046..3525490 [+]
Productconjugal transfer ATPase TrbE
Component typeTrbE
UniProt IDA5EH22
KEGG IDbbt:BBta_3367
PDB IDNA
Domain hit(s) vs Pfam AAA_10 [PF12846], Evalue: 2.3e-32, Aligned region: 443..726
CagE_TrbE_VirB [PF03135], Evalue: 4.4e-10, Aligned region: 182..389
Protein Sequence: 814 a.a.     [Download]
>gi|148254787|ref|YP_001239372.1| conjugal transfer ATPase TrbE [Bradyrhizobium sp. BTAi1]
MMNLREYRNSNARLSDYLPWAALVDHGIVLNKDGSLQRSARFRGPDLDSAVPAELVAVAGRLNNALRRLG
SGWAIFVEAFRYPSQLYPASQFPDPASALVEAERRAQFQAQGAHFESNYFLTFVYLPPSEDASRAERWLY
EGRAQGEGGDAQEILRGFADRTDRILQLLDGFMPECRWLDDEETLTYLHATISTKLQRVRVPEIPVHLDA
LLADRPLTGGLEPRLGDAHLRVLTIVGFPTATTPGILDELNALAFPYRWSTRAIMLDKSDATRLLTRIRR
QWFAKRKSIAALLKEVVTNEAAALVDTDAHNKALDADAALQDLGSDLIGEALVTATITVWDEDPRIADER
LRLAEKVIQGRDFTCMVETVNAVEAWLGSLPGHVYANVRQPPVSTLNIAHMIPLSAVWAGPQRDQHLGAP
PLFVARTEGATPFRFSLHVGDVGHTLVVGPTGAGKSVLLALMAMQFRRYPGSQVFAFDFGGSIRAAALAM
GGDWHDLGGALSDEASEAVALQPLAAIEDATERGWAADWIAAILAREQISITPEVRDHLWSALTSLASAP
VSERTLTGLSILLQSNVLKRALQPFCLGGGPYGRLLDADAERLGGASVQAFETEGLIGTAAAPAVLAYLF
HRIEGQLDGRPTLLIVDEGWLALDDDGFAGQLREWLKTLRKKNASVVFATQSLSDIDGSKIAPAIIESCP
TRLLLPNERALEPQITAIYRRFGLNDRQIEILARATPKRDYYCQSRRGNRLFELGLGEVALALIAASSKT
DQADMTRVLAEHGQDGFLAGWLTHRGVSWAIDLIPHLNGREVLA
 
Nucleotide Sequence: 2445 bp     [Download]
>gi|148251626|ref|NC_009485.1|:3523046-3525490 Bradyrhizobium sp. BTAi1 chromosome, complete genome
ATGATGAACTTGCGCGAATATCGCAACAGCAATGCGCGCCTGTCCGATTATCTGCCATGGGCCGCTCTGG
TCGATCATGGAATCGTCCTCAACAAGGATGGCTCGCTGCAGCGGAGCGCGCGCTTTCGCGGGCCGGATCT
TGACTCGGCGGTACCGGCCGAGCTCGTGGCTGTGGCCGGTCGGCTCAATAATGCCCTGCGGAGGCTTGGC
TCTGGATGGGCCATCTTCGTCGAGGCGTTCAGGTATCCGTCGCAGCTCTATCCCGCGAGCCAATTCCCTG
ATCCGGCCTCGGCGCTGGTAGAGGCCGAGCGCCGGGCGCAGTTCCAGGCGCAGGGCGCGCATTTCGAGTC
GAACTATTTCCTGACCTTCGTCTATCTGCCGCCGTCAGAAGATGCCTCACGCGCCGAGCGCTGGCTGTAT
GAGGGACGCGCGCAAGGCGAGGGCGGTGATGCCCAGGAAATCCTGCGTGGTTTCGCCGACCGCACGGATC
GCATCCTGCAGCTGCTCGACGGCTTCATGCCGGAGTGTCGCTGGCTCGACGACGAGGAGACGCTGACCTA
TCTGCACGCGACCATCTCGACCAAGCTGCAGCGTGTCCGCGTCCCCGAAATCCCTGTTCATCTCGATGCG
CTGCTGGCCGATCGACCGCTGACAGGAGGCCTCGAGCCGCGGCTGGGCGACGCTCACCTGCGGGTACTGA
CGATCGTCGGTTTCCCGACCGCCACCACGCCAGGAATCCTCGACGAGCTCAATGCGCTGGCGTTTCCCTA
TCGCTGGTCGACCCGGGCGATCATGCTCGACAAGAGCGACGCGACCAGGCTGCTGACCAGGATCCGGCGG
CAGTGGTTCGCCAAGCGCAAGTCGATTGCCGCGCTCCTCAAGGAAGTCGTGACCAACGAGGCCGCCGCGC
TGGTCGACACCGATGCCCACAATAAGGCGCTCGACGCCGATGCGGCGCTGCAGGATCTCGGCTCCGATCT
GATCGGGGAGGCCTTGGTCACCGCGACCATCACGGTCTGGGATGAGGATCCGCGCATTGCCGATGAGCGA
TTGCGGCTCGCCGAGAAGGTGATCCAGGGCCGCGACTTTACCTGCATGGTCGAGACGGTCAATGCGGTCG
AGGCTTGGCTTGGGTCGCTGCCTGGCCACGTCTACGCCAATGTGCGCCAGCCGCCGGTCTCGACCCTGAA
CATTGCGCATATGATCCCGCTATCGGCGGTCTGGGCCGGCCCGCAGCGCGATCAGCATCTCGGTGCGCCG
CCGCTGTTCGTGGCGCGCACCGAGGGCGCGACGCCGTTCCGGTTCTCGCTGCACGTCGGCGACGTCGGGC
ACACGCTCGTGGTGGGTCCGACCGGGGCCGGCAAGTCGGTGCTGCTGGCGTTGATGGCGATGCAGTTCCG
CCGCTATCCCGGCTCCCAGGTGTTCGCCTTCGATTTCGGCGGCTCGATCCGCGCGGCCGCGCTCGCCATG
GGCGGCGACTGGCATGATCTCGGCGGGGCCTTGTCGGACGAGGCATCGGAAGCGGTCGCGCTGCAGCCGC
TTGCGGCGATTGAGGATGCGACGGAGCGCGGCTGGGCGGCCGACTGGATCGCGGCCATCCTTGCGCGCGA
GCAGATCAGCATCACGCCCGAGGTGCGGGACCATCTGTGGTCGGCGCTGACATCGCTGGCGTCGGCGCCG
GTGTCTGAGCGGACACTGACGGGCCTCTCCATCCTGCTGCAGTCCAATGTGCTGAAGCGGGCGTTGCAGC
CATTTTGTCTCGGTGGCGGCCCTTACGGCCGGCTGCTCGATGCCGACGCCGAGCGGCTCGGTGGTGCGTC
CGTTCAGGCGTTCGAGACCGAAGGTCTAATCGGCACGGCGGCAGCGCCTGCCGTGCTCGCCTATCTCTTT
CACCGCATCGAAGGCCAGCTCGACGGCCGCCCGACGCTTCTGATCGTCGACGAAGGATGGCTCGCGCTCG
ACGACGACGGCTTTGCCGGCCAGCTCCGGGAGTGGCTGAAGACGCTGCGCAAGAAGAACGCGTCTGTCGT
CTTCGCCACGCAGTCGCTGTCCGACATCGATGGATCAAAGATTGCCCCCGCCATCATCGAGAGCTGCCCC
ACCCGGTTGTTGCTGCCGAACGAGCGCGCGCTCGAGCCGCAGATCACAGCCATCTATCGACGGTTCGGCC
TGAACGACCGCCAGATCGAGATCCTGGCCCGGGCCACACCGAAGCGGGACTATTACTGCCAGTCGCGCCG
CGGCAACCGTCTCTTTGAGCTCGGTCTCGGCGAGGTCGCGCTGGCGCTGATTGCGGCGTCCTCAAAGACC
GACCAGGCCGACATGACGCGCGTGCTTGCCGAACACGGACAGGATGGCTTCCTAGCCGGCTGGCTCACCC
ATCGCGGCGTGTCCTGGGCGATCGACCTCATTCCCCATCTGAATGGCCGGGAAGTCCTCGCATGA
 Primer design