SecReT4
Protein ID: 148254788
T4SS name [ID]Trb [336]
Gene symbol-
Locus tagBBta_3368
StrainBradyrhizobium sp. BTAi1
Repliconchromosome [GenBank: NC_009485] [Browse all T4SS(s) in this replicon]
Location [Strand]3525487..3526224 [+]
Productconjugal transfer protein TrbJ
Component typeTrbJ
UniProt IDA5EH23
KEGG IDbbt:BBta_3368
PDB IDNA
Domain hit(s) vs Pfam DUF4141 [PF13605], Evalue: 7.1e-06, Aligned region: 15..48
Protein Sequence: 245 a.a.     [Download]
>gi|148254788|ref|YP_001239373.1| conjugal transfer protein TrbJ [Bradyrhizobium sp. BTAi1]
MTDPRGLARGAAAAVVIWAASTCMSSAQLVVFDPNNYAQNVLTAVRELQQINNQIISLQNQAQMLINQAK
NLASLPYSSLAQLQQSIQRTQQLLKEAQRLAYDVQQIDKAFATTYAPASSSQSSQALVESAQARWQTSVA
ALQDALKVQAGVVGNLNTVKTQSSALIAASQGASGALQVTQAGNQILALQAQQLADLTASVAAQGRAAML
DAAQRAAAQDQGREQLKRFLTPGQGYQPSNVRMFH
 
Nucleotide Sequence: 738 bp     [Download]
>gi|148251626|ref|NC_009485.1|:3525487-3526224 Bradyrhizobium sp. BTAi1 chromosome, complete genome
ATGACGGATCCTCGTGGTCTCGCCCGTGGCGCTGCGGCAGCCGTCGTCATCTGGGCGGCGTCGACCTGCA
TGTCGTCGGCGCAGCTGGTCGTGTTCGATCCGAACAATTACGCCCAGAACGTCCTGACCGCCGTGCGCGA
GCTGCAGCAGATCAACAATCAAATCATCTCGCTGCAGAACCAGGCGCAGATGCTGATCAACCAGGCGAAG
AATCTTGCGAGTCTGCCGTATTCGTCGCTGGCGCAGTTGCAGCAGTCGATCCAGCGCACTCAGCAGCTGC
TCAAGGAGGCCCAGCGCCTCGCCTATGATGTGCAGCAGATCGACAAGGCGTTCGCGACCACCTATGCGCC
GGCGAGCAGCAGCCAATCGAGTCAGGCGCTGGTGGAGAGTGCGCAGGCGCGCTGGCAGACTTCGGTGGCG
GCGCTGCAGGATGCGCTCAAGGTCCAAGCGGGCGTCGTCGGCAATCTCAACACGGTCAAGACCCAGTCCT
CCGCGCTCATTGCGGCGAGCCAAGGCGCGAGCGGGGCTTTGCAGGTCACCCAGGCCGGCAACCAGATCCT
TGCGCTGCAGGCTCAGCAATTGGCCGATCTCACCGCGAGCGTGGCCGCGCAGGGCCGGGCCGCGATGCTG
GATGCTGCCCAGCGCGCCGCCGCTCAGGATCAGGGTCGCGAGCAGCTCAAGCGCTTCCTGACGCCAGGTC
AAGGCTACCAGCCCTCCAACGTACGGATGTTCCATTGA
 Primer design