SecReT4
Protein ID: 148254790
T4SS name [ID]Trb [336]
Gene symbol-
Locus tagBBta_3370
StrainBradyrhizobium sp. BTAi1
Repliconchromosome [GenBank: NC_009485] [Browse all T4SS(s) in this replicon]
Location [Strand]3526535..3527758 [+]
Productconjugal transfer protein TrbL
Component typeTrbL
UniProt IDA5EH25
KEGG IDbbt:BBta_3370
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 6.6e-51, Aligned region: 38..262
Protein Sequence: 407 a.a.     [Download]
>gi|148254790|ref|YP_001239375.1| conjugal transfer protein TrbL [Bradyrhizobium sp. BTAi1]
MTGTGIIDQFLETFTRTIDSGFGLVSGDVGMLATTLAAIDLTLAALFWVWGREDDVIARLVKKTLFVGVF
AYLIGNWNSLARIVFESFAGLGLKASGSALSVADFLRPGKIAQVGLDAGRPMLQATANLMGYVSFFENFV
QIAVLLFAWIVVLLAFFILAIQLFVTLIEFKLTTLAGFVLIPFGLFGKTAFAAERVLGNVISSGIKVLVL
AVIVGIGSTQFSQLISAGNGDPPTIESAMTLVLGALSLLGLGIFGPGIANGLVSGGPQLGASSAAGAALA
AGGLAVAGAGLIAGGAGLTSAAATGSGRGASALGGAVVRALRSGREPSPSEASVASPLRQAAAANAGGPS
SAASADGGGSPSGSPRWAEQLKAGRAVSQGTSAATQAVRSAGQGGQGSSVDLSEDKP
 
Nucleotide Sequence: 1224 bp     [Download]
>gi|148251626|ref|NC_009485.1|:3526535-3527758 Bradyrhizobium sp. BTAi1 chromosome, complete genome
ATGACCGGGACCGGAATCATCGATCAGTTCCTGGAGACGTTCACCCGCACGATCGACTCCGGCTTCGGTC
TCGTCAGCGGCGATGTCGGTATGCTGGCGACGACGCTGGCTGCGATCGATCTCACCCTCGCTGCCTTGTT
CTGGGTCTGGGGCCGCGAGGACGATGTCATCGCACGCCTCGTGAAGAAAACGTTGTTCGTCGGCGTTTTC
GCCTATTTGATCGGCAACTGGAACAGCCTCGCCCGGATCGTCTTCGAGAGCTTTGCTGGCCTCGGTCTGA
AGGCGTCGGGCTCCGCGCTCTCGGTTGCCGACTTCCTGCGTCCGGGCAAGATCGCGCAGGTCGGCCTCGA
TGCCGGGCGACCGATGCTGCAGGCCACCGCCAATCTGATGGGGTATGTCAGCTTCTTCGAGAATTTCGTC
CAGATCGCGGTTTTGCTGTTTGCCTGGATCGTGGTGCTGCTCGCCTTCTTCATCCTGGCAATCCAGCTCT
TCGTCACCCTGATCGAGTTCAAATTGACGACGCTTGCTGGCTTCGTGCTGATCCCGTTCGGTCTGTTCGG
CAAGACGGCCTTTGCCGCGGAGCGCGTGCTCGGCAACGTGATCTCCTCCGGCATCAAGGTCCTGGTGCTC
GCCGTGATCGTCGGCATCGGCTCGACCCAGTTCTCGCAGTTGATCTCGGCCGGCAACGGTGATCCGCCGA
CCATCGAAAGCGCGATGACGCTCGTCCTCGGCGCACTGTCGTTGCTCGGCCTCGGCATTTTCGGTCCCGG
TATCGCCAACGGCCTCGTCTCCGGCGGACCGCAGCTCGGAGCCTCATCCGCGGCAGGCGCGGCGCTCGCG
GCAGGCGGTCTCGCTGTTGCCGGCGCTGGGCTCATTGCGGGCGGTGCCGGTCTTACCAGTGCGGCGGCGA
CCGGTAGCGGTCGAGGCGCGTCGGCGCTGGGCGGCGCAGTGGTCCGGGCGCTACGCAGTGGCCGAGAGCC
ATCCCCGTCGGAGGCTTCCGTCGCCAGCCCATTGCGACAGGCCGCTGCGGCCAACGCGGGCGGCCCTTCG
TCCGCAGCTTCGGCGGATGGCGGAGGTTCCCCATCGGGCTCGCCGCGATGGGCCGAACAGCTGAAGGCAG
GCCGGGCCGTCAGTCAGGGCACCTCAGCGGCGACACAGGCTGTGCGCAGCGCTGGACAGGGCGGGCAGGG
CAGCTCCGTCGATCTCTCGGAGGACAAACCATGA
 Primer design