SecReT4
Protein ID: 148254791
T4SS name [ID]Trb [336]
Gene symboltrbF
Locus tagBBta_3371
StrainBradyrhizobium sp. BTAi1
Repliconchromosome [GenBank: NC_009485] [Browse all T4SS(s) in this replicon]
Location [Strand]3527761..3528444 [+]
Productconjugal transfer protein TrbF
Component typeTrbF
UniProt IDA5EH26
KEGG IDbbt:BBta_3371
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 3.7e-58, Aligned region: 21..224
Protein Sequence: 227 a.a.     [Download]
>gi|148254791|ref|YP_001239376.1| conjugal transfer protein TrbF [Bradyrhizobium sp. BTAi1]
MFKRPAVHYGRTLQPVTPYQKAAQVWDERIGSARVQARNWRLMAFGCLTLASGLAAALVWQSARGSVTPW
VVEVGHLGDVQRVAPAIAEYQPTDPQIAFHLARFIEDVRSLPADPIVLRQSWLRAYDFTSDRGAAALNDY
ARTNDPFARLGKAQVSVEVSSVIRASSESFRVAWIERHYDNGALSATERWTAILTIVLAMPDDADRLRKN
PLGVYVHAISWSKELSQ
 
Nucleotide Sequence: 684 bp     [Download]
>gi|148251626|ref|NC_009485.1|:3527761-3528444 Bradyrhizobium sp. BTAi1 chromosome, complete genome
ATGTTCAAACGTCCCGCTGTCCATTACGGCCGCACGCTGCAACCGGTCACGCCGTATCAGAAAGCTGCGC
AGGTCTGGGATGAGCGCATCGGCTCGGCGCGTGTGCAAGCCAGGAATTGGCGGCTGATGGCGTTCGGGTG
CCTGACGCTGGCTAGCGGCCTGGCCGCAGCCCTCGTCTGGCAATCGGCACGAGGCAGTGTGACGCCCTGG
GTGGTGGAGGTCGGCCATCTCGGAGACGTACAGCGGGTGGCCCCCGCGATTGCCGAGTATCAACCGACCG
ATCCGCAGATCGCCTTTCATCTCGCGCGCTTCATCGAGGACGTGAGAAGCCTCCCCGCCGATCCCATCGT
CCTGCGCCAGAGCTGGCTGCGCGCCTATGACTTCACGAGCGATCGCGGGGCAGCAGCGCTCAATGACTAC
GCCCGGACGAACGATCCGTTCGCGAGGCTCGGCAAAGCCCAGGTCTCGGTGGAGGTCTCCAGCGTCATCC
GGGCCTCGTCCGAGAGCTTTCGCGTGGCATGGATCGAGCGGCACTACGACAATGGCGCGCTGAGTGCGAC
GGAGCGCTGGACCGCCATTCTCACCATCGTGCTCGCGATGCCTGACGATGCCGACCGGCTGCGCAAGAAC
CCTCTTGGGGTTTATGTCCACGCCATCAGCTGGTCGAAGGAGCTGTCGCAATGA
 Primer design