SecReT4
Protein ID: 148254792
T4SS name [ID]Trb [336]
Gene symbol-
Locus tagBBta_3372
StrainBradyrhizobium sp. BTAi1
Repliconchromosome [GenBank: NC_009485] [Browse all T4SS(s) in this replicon]
Location [Strand]3528441..3529388 [+]
Productconjugal transfer protein TrbG
Component typeTrbG
UniProt IDA5EH27
KEGG IDbbt:BBta_3372
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 4.5e-65, Aligned region: 93..308
Protein Sequence: 315 a.a.     [Download]
>gi|148254792|ref|YP_001239377.1| conjugal transfer protein TrbG [Bradyrhizobium sp. BTAi1]
MNGRILTATALSFLLSGCATSKPPEIRYDAEVPPLPAAPVTVDDRPRALHVPPPWKVTFGGKAGTKEEGD
PVDRIEMANDAARVEPRKQGYYNAAQIYAYSPGAIYQVYAAPGQITDIALEPGEQLTGSGPVAAGDTVRW
VVGDTESGAGDTRRVHILVKPTRAGIETNLVVNTDRRTYLIELRAREKPYMPAVAWYYPEANAAGRAIVA
LTPVLPDPAQRRFRYRIEGDDPPWRPVIVYDDGRKVYVEFSPGIVQGEMPPLFVTGSDGKPEIVNYRAHG
NVLIVDRLFAAAELRLGGDPQQTVRIVRTDGQVRP
 
Nucleotide Sequence: 948 bp     [Download]
>gi|148251626|ref|NC_009485.1|:3528441-3529388 Bradyrhizobium sp. BTAi1 chromosome, complete genome
ATGAACGGCCGCATCCTCACCGCGACGGCGCTTTCGTTTCTGCTGAGCGGCTGCGCCACGTCGAAGCCGC
CGGAGATCCGTTATGACGCCGAGGTGCCACCGTTACCGGCAGCGCCTGTCACGGTTGATGACAGGCCGCG
GGCGCTCCATGTGCCGCCGCCATGGAAGGTGACCTTCGGTGGTAAGGCTGGCACGAAGGAGGAGGGCGAT
CCTGTCGATCGGATCGAAATGGCCAACGATGCGGCACGCGTCGAACCGCGCAAGCAGGGTTATTACAACG
CGGCGCAGATCTATGCTTATAGTCCAGGAGCGATCTATCAGGTCTACGCAGCACCGGGGCAAATTACCGA
TATCGCGCTCGAGCCAGGTGAACAGCTCACGGGATCAGGCCCGGTCGCGGCCGGCGACACCGTGCGGTGG
GTGGTCGGCGATACCGAGAGCGGCGCGGGCGATACGCGTCGCGTCCACATCCTGGTCAAGCCGACGCGCG
CAGGCATCGAGACCAATCTCGTCGTCAACACCGACCGCCGCACCTATCTGATTGAGCTGCGCGCCCGCGA
GAAGCCATACATGCCGGCCGTGGCCTGGTACTATCCGGAAGCGAATGCTGCGGGCAGGGCAATCGTAGCC
CTGACGCCCGTCCTGCCAGATCCCGCGCAGCGCCGCTTCCGCTATCGCATCGAGGGCGATGATCCGCCAT
GGCGACCGGTGATCGTCTATGACGACGGCCGCAAGGTCTATGTTGAATTCTCTCCCGGCATCGTCCAAGG
CGAGATGCCGCCATTGTTCGTGACCGGATCCGACGGCAAGCCGGAGATCGTCAACTATCGAGCTCATGGC
AACGTCTTGATCGTGGATCGGCTGTTCGCGGCAGCCGAGCTGCGCCTGGGCGGCGACCCGCAGCAGACCG
TGCGGATCGTTCGCACCGACGGACAGGTTCGGCCATGA
 Primer design