SecReT4
Protein ID: 148254793
T4SS name [ID]Trb [336]
Gene symbol-
Locus tagBBta_3373
StrainBradyrhizobium sp. BTAi1
Repliconchromosome [GenBank: NC_009485] [Browse all T4SS(s) in this replicon]
Location [Strand]3529385..3530587 [+]
Productconjugal transfer protein TrbI
Component typeTrbI
UniProt IDA5EH28
KEGG IDbbt:BBta_3373
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 3.5e-63, Aligned region: 212..395
Protein Sequence: 400 a.a.     [Download]
>gi|148254793|ref|YP_001239378.1| conjugal transfer protein TrbI [Bradyrhizobium sp. BTAi1]
MSAEGKGTSARPNDPEPAADPAASFRLGGEPPRITRLSRKILASGSAVALALIAGAVLWALQSPGTRKPA
AQSELASSGHREVADGVSSLPRDYTQIATDVPVLGPPLPGDLGRPILASQGQMPGSSQDQEQQRREQEQE
AARVSRLFATTTTTATQPSPNVAQGVGLGGVPAATDDAFAQNGQDRKLAFVSGPVDRRTTSPDRLTRPAS
PYVVQAGTVIPGALITGIRSDLPGQIEAQVTENVFDTPSGRFLLVPQGARLIGVYDSQVAAGQSRVLLVW
TRLVMPNGRSIVLERQPGADAGGYAGLSDEVDNHWKQIAGAALLSTLLSMGSGVNAGANPNTNNAAIIQA
LRQGFGNAVSQTGQQLVRQQMDIQPTLTVRPGFPVRVIVNRDLVLEPYQG
 
Nucleotide Sequence: 1203 bp     [Download]
>gi|148251626|ref|NC_009485.1|:3529385-3530587 Bradyrhizobium sp. BTAi1 chromosome, complete genome
ATGAGCGCGGAGGGCAAAGGCACGAGCGCACGGCCGAACGATCCGGAGCCGGCTGCCGATCCTGCGGCGT
CCTTCCGCCTTGGCGGAGAGCCGCCACGGATCACTCGGTTGTCGCGCAAGATTCTGGCCAGCGGCAGCGC
CGTGGCGCTCGCGCTGATCGCAGGCGCCGTTCTGTGGGCGCTGCAAAGCCCTGGCACGCGCAAGCCGGCG
GCCCAATCCGAGCTCGCCAGTTCGGGGCATCGCGAGGTCGCAGATGGCGTCTCCAGCCTGCCGCGTGACT
ACACGCAAATTGCCACGGATGTCCCGGTGCTCGGGCCGCCGTTGCCCGGCGATCTCGGACGGCCAATCCT
TGCCTCCCAGGGGCAAATGCCGGGTTCAAGTCAAGACCAGGAGCAGCAGCGCCGCGAACAGGAGCAGGAG
GCCGCGCGCGTCAGCCGGCTGTTTGCGACGACCACGACGACGGCAACGCAACCCTCGCCAAATGTGGCTC
AGGGCGTCGGGCTTGGAGGGGTGCCGGCGGCCACGGACGACGCCTTCGCGCAGAACGGCCAGGACCGAAA
ACTCGCCTTCGTGAGCGGGCCGGTGGATCGGCGCACCACGAGCCCTGATCGCCTCACGCGGCCGGCTTCG
CCTTACGTCGTGCAGGCTGGCACGGTCATTCCGGGCGCCCTGATCACTGGCATTCGCTCCGACCTGCCGG
GACAAATCGAGGCGCAAGTCACCGAAAATGTCTTCGATACACCTTCGGGACGATTCCTGTTGGTGCCCCA
GGGAGCACGGCTGATCGGCGTCTACGACAGCCAGGTAGCGGCTGGACAATCCCGCGTGCTCTTGGTCTGG
ACCCGTCTGGTCATGCCCAACGGCCGCTCGATCGTGCTCGAGCGGCAGCCGGGCGCGGATGCCGGCGGCT
ATGCGGGGCTGTCGGACGAGGTCGACAATCATTGGAAGCAGATTGCGGGCGCAGCTCTGCTCTCGACGCT
CCTCTCCATGGGCAGCGGGGTGAATGCCGGCGCCAATCCGAATACCAACAACGCCGCGATCATCCAGGCC
CTTCGTCAGGGCTTCGGCAATGCCGTGAGTCAGACCGGTCAGCAGCTCGTACGTCAGCAGATGGACATCC
AACCGACATTGACAGTCAGGCCAGGGTTTCCGGTACGGGTGATCGTCAATCGGGATCTCGTGCTTGAGCC
GTATCAAGGATGA
 Primer design