SecReT4
Protein ID: 148258621
T4SS name [ID]Trb [337]
Gene symbol-
Locus tagBBta_7441
StrainBradyrhizobium sp. BTAi1
Repliconchromosome [GenBank: NC_009485] [Browse all T4SS(s) in this replicon]
Location [Strand]7816602..7816925 [+]
Productconjugal transfer protein
Component typeTrbC
UniProt IDA5ET06
KEGG IDbbt:BBta_7441
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 4e-26, Aligned region: 3..98
Protein Sequence: 107 a.a.     [Download]
>gi|148258621|ref|YP_001243206.1| conjugal transfer protein [Bradyrhizobium sp. BTAi1]
MLIKDARRAFATATAFVFVALATAPAYAAGSNMPWEQPLNQILESIQGPVAKVVSVIIIIVTGLTLAFGE
TSGGFRRLIQIVFGLSIAFAASSFFLTFFQFGGGVTV
 
Nucleotide Sequence: 324 bp     [Download]
>gi|148251626|ref|NC_009485.1|:7816602-7816925 Bradyrhizobium sp. BTAi1 chromosome, complete genome
ATGTTAATCAAGGATGCCCGCCGTGCGTTCGCCACGGCAACCGCCTTCGTCTTCGTCGCCCTCGCAACCG
CGCCGGCCTATGCGGCCGGATCGAACATGCCGTGGGAGCAGCCGCTCAACCAGATCCTGGAGAGCATCCA
AGGGCCCGTGGCCAAGGTCGTGTCGGTGATCATCATTATCGTCACCGGTCTGACGCTCGCCTTCGGCGAG
ACCAGCGGCGGCTTCCGTCGCCTCATTCAGATCGTCTTCGGCCTCAGCATCGCCTTCGCAGCGTCGAGCT
TCTTCCTGACCTTCTTCCAGTTCGGCGGCGGGGTGACGGTGTGA
 Primer design