SecReT4
Protein ID: 148258626
T4SS name [ID]Trb [337]
Gene symbol-
Locus tagBBta_7446
StrainBradyrhizobium sp. BTAi1
Repliconchromosome [GenBank: NC_009485] [Browse all T4SS(s) in this replicon]
Location [Strand]7820700..7821962 [+]
Productconjugal transfer protein TrbL
Component typeTrbL
UniProt IDA5ET11
KEGG IDbbt:BBta_7446
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 7.5e-51, Aligned region: 37..261
Protein Sequence: 420 a.a.     [Download]
>gi|148258626|ref|YP_001243211.1| conjugal transfer protein TrbL [Bradyrhizobium sp. BTAi1]
MGGTGVIDNFLGTFTQYIDSGFGLVQGDVRWLASVLIAIDITLAGLFWAMAPDEDVLARLIRKTLYIGLF
AFIIGNYNNLAQIIYNSFAGLGIKAGGGTMSAAQLLQPGKIAEVGIDAGKPILTAISGMMGFTSVFANLV
QIVILLVAWLIVVISFFVMAIQLFVSLIEFKLTTLAGFVLVPFGLFGRTAFLAERVLGNVVSSGIKILVL
AVIIGIGSTIFNQFTSGFNNPPTISDALTLILAALSLLGLTIFGPGIANGLIAGGPQLGAGAAVATGLGA
AGIGAAGIAATAGGVAAAGGAIAGTARAGAAVAGGASAAYRAGGAAGVAQAAGSVAMSPLRRAASSLQES
FASGERAVMSGGARSSSSAGASAASDSPPAWAQRMKRGQTINRGVTAADHAIRSGDRASGGHQVDLSEGE
 
Nucleotide Sequence: 1263 bp     [Download]
>gi|148251626|ref|NC_009485.1|:7820700-7821962 Bradyrhizobium sp. BTAi1 chromosome, complete genome
ATGGGCGGCACGGGAGTCATCGACAATTTCCTGGGCACCTTCACCCAGTATATCGATTCCGGCTTCGGCC
TCGTTCAAGGTGACGTGCGCTGGCTCGCCAGCGTCCTCATCGCCATCGACATCACGCTGGCGGGGCTCTT
CTGGGCGATGGCGCCCGACGAGGACGTGCTCGCGCGCCTGATCCGCAAGACGCTCTATATCGGCCTCTTC
GCCTTCATCATCGGCAACTACAACAATCTCGCGCAGATCATCTACAACAGCTTCGCCGGCCTCGGGATCA
AGGCCGGTGGCGGCACGATGAGCGCTGCGCAGCTCCTGCAGCCCGGCAAGATCGCCGAGGTCGGGATCGA
TGCCGGCAAGCCGATCCTCACCGCCATCTCCGGTATGATGGGCTTCACCAGCGTCTTCGCCAATCTGGTG
CAGATCGTCATTCTTCTGGTCGCGTGGCTGATCGTCGTCATCAGCTTCTTCGTCATGGCGATCCAGCTCT
TTGTGAGTTTGATCGAGTTCAAGCTGACGACGTTGGCCGGTTTCGTACTCGTGCCGTTCGGGCTCTTCGG
CCGTACGGCCTTCCTCGCCGAACGGGTGCTGGGCAACGTGGTGTCCAGCGGGATCAAGATTCTCGTGCTC
GCCGTCATCATCGGCATCGGCTCCACGATCTTCAATCAATTCACCAGCGGCTTCAACAATCCGCCGACAA
TTTCCGACGCGCTGACGCTGATCCTCGCAGCGCTCTCGCTCCTTGGCCTCACGATCTTCGGTCCAGGCAT
CGCCAATGGCCTGATCGCGGGCGGACCGCAGCTCGGCGCCGGCGCGGCTGTCGCGACAGGATTGGGAGCG
GCCGGGATCGGAGCGGCCGGCATTGCGGCGACCGCCGGGGGTGTCGCCGCGGCCGGCGGCGCGATCGCCG
GGACGGCGCGCGCGGGAGCCGCGGTCGCGGGCGGCGCCAGCGCCGCATATCGCGCGGGTGGGGCAGCGGG
TGTCGCCCAAGCTGCCGGCTCAGTCGCCATGAGCCCACTGCGCCGCGCCGCCAGCAGCCTTCAAGAAAGC
TTCGCCTCTGGCGAGCGTGCCGTCATGAGCGGCGGCGCGCGCTCGTCGTCATCCGCCGGCGCGTCCGCCG
CGTCGGACAGCCCGCCAGCATGGGCCCAGCGCATGAAGCGCGGCCAGACCATCAACCGCGGCGTCACCGC
CGCCGACCACGCAATCCGCTCCGGTGATCGGGCAAGCGGCGGGCATCAGGTCGATCTTTCCGAGGGGGAA
TAG
 Primer design