SecReT4
Protein ID: 148258628
T4SS name [ID]Trb [337]
Gene symbol-
Locus tagBBta_7448
StrainBradyrhizobium sp. BTAi1
Repliconchromosome [GenBank: NC_009485] [Browse all T4SS(s) in this replicon]
Location [Strand]7822646..7823632 [+]
Productconjugal transfer protein TrbG
Component typeTrbG
UniProt IDA5ET13
KEGG IDbbt:BBta_7448
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 4.3e-68, Aligned region: 100..322
Protein Sequence: 328 a.a.     [Download]
>gi|148258628|ref|YP_001243213.1| conjugal transfer protein TrbG [Bradyrhizobium sp. BTAi1]
MRPLAISSLLLASVSLGACATAWKPPQISYDNTPKPAVLQAEPPKPIQIVEVPKPLPLPGQLKPLPGNTK
RAPEPADPHARVDQANGAARVQPTRAGYLNAIQVYPFSDGALYQVYAAPGQITDIALEPGEQLTGSGPVA
AGDTVRWIIGDTESGAGPAKRVHILVKPTRADLITNLVINTDRRTYHLELHSDDKTYMASVSWAYAQDQL
IALRQQNAAAEAAAPVATGVDINALNFRYRIEGDTPPWRPLRAFDDGRQVFIEFPTGISQGELPPLWVIG
AEGDGQLVNYRVRGNHMIVDRLFAAAELKLGGKHQELVRIVRTDGRPR
 
Nucleotide Sequence: 987 bp     [Download]
>gi|148251626|ref|NC_009485.1|:7822646-7823632 Bradyrhizobium sp. BTAi1 chromosome, complete genome
ATGCGCCCGCTTGCGATCTCGTCGCTCTTACTTGCGTCTGTCTCCCTCGGCGCCTGCGCCACAGCCTGGA
AACCGCCGCAGATCAGCTACGACAACACGCCGAAGCCCGCGGTGCTGCAGGCCGAGCCGCCCAAGCCCAT
TCAGATCGTCGAGGTGCCGAAGCCGTTGCCGCTGCCCGGACAACTCAAGCCGCTGCCCGGGAACACGAAG
CGCGCCCCCGAACCTGCGGATCCGCATGCTCGCGTCGATCAGGCCAATGGCGCGGCCCGCGTCCAGCCGA
CACGGGCAGGCTATCTCAACGCTATCCAGGTCTACCCCTTTTCCGATGGCGCGCTGTATCAGGTCTATGC
CGCGCCGGGCCAAATCACCGACATCGCGCTCGAGCCGGGCGAGCAGTTGACGGGCTCAGGGCCTGTCGCT
GCCGGAGATACCGTGCGGTGGATCATCGGCGACACCGAGAGCGGCGCCGGGCCAGCCAAACGTGTCCACA
TCCTGGTGAAGCCCACCCGTGCGGATCTCATCACCAACCTTGTCATCAATACAGACCGCCGGACCTATCA
CCTCGAGCTGCATTCCGACGACAAGACGTATATGGCGTCGGTCTCTTGGGCTTATGCGCAGGATCAGCTC
ATCGCGCTGCGCCAGCAGAATGCGGCCGCCGAGGCCGCTGCCCCCGTCGCAACCGGCGTCGACATCAATG
CACTGAACTTCCGCTATCGCATCGAGGGCGATACTCCGCCGTGGCGGCCGCTGCGCGCCTTCGATGACGG
CCGGCAGGTGTTCATCGAATTCCCGACCGGGATCTCACAGGGTGAGCTGCCACCGCTCTGGGTGATCGGC
GCGGAAGGCGACGGCCAGCTCGTCAACTACCGTGTCCGCGGCAATCACATGATCGTCGACCGCCTGTTCG
CTGCGGCGGAGCTGAAGCTCGGCGGCAAGCACCAGGAGCTGGTGCGCATCGTCCGCACCGATGGGAGGCC
GCGGTGA
 Primer design