SecReT4
Protein ID: 148258897
T4SS name [ID]Trb [338]
Gene symbol-
Locus tagBBta_7735
StrainBradyrhizobium sp. BTAi1
Repliconchromosome [GenBank: NC_009485] [Browse all T4SS(s) in this replicon]
Location [Strand]8126824..8127369 [+]
Productconjugal transfer protein
Component typeTraF
UniProt IDA5ETT2
KEGG IDbbt:BBta_7735
PDB IDNA
Domain hit(s) vs Pfam Peptidase_S26 [PF10502], Evalue: 2.7e-54, Aligned region: 29..166
Protein Sequence: 181 a.a.     [Download]
>gi|148258897|ref|YP_001243482.1| conjugal transfer protein [Bradyrhizobium sp. BTAi1]
MTRLGYVMTTSLAVVAVGVLSFLPVTPRLIWNASASVPLGLYSIAPARHLEVTDLVAVETPEPLASFMAE
RRYLPRGVPLMKRVAAVAGQQVCRDGSHITVDGIDMGDALARDRAGRVLPSWQGCRRIAHGEVFLMNWAA
PDSMDGRYFGPLATKTIIGRAVPLWTDEDGDGRFQWHAATR
 
Nucleotide Sequence: 546 bp     [Download]
>gi|148251626|ref|NC_009485.1|:8126824-8127369 Bradyrhizobium sp. BTAi1 chromosome, complete genome
GTGACGCGCCTCGGCTATGTCATGACGACCTCCCTCGCCGTGGTGGCGGTCGGCGTTCTCTCCTTCCTTC
CAGTGACGCCGAGGCTCATCTGGAATGCGTCCGCCAGCGTACCGCTCGGCCTCTATTCCATCGCGCCGGC
GCGTCACCTCGAAGTCACCGATCTCGTCGCGGTCGAGACGCCCGAGCCGCTCGCCTCCTTCATGGCCGAA
CGCCGCTATCTGCCCCGCGGCGTGCCGCTGATGAAGCGCGTCGCCGCCGTTGCTGGCCAGCAGGTTTGCC
GGGACGGATCGCACATCACGGTCGACGGGATCGACATGGGCGACGCGCTGGCGCGCGACCGCGCCGGCCG
TGTCTTGCCGTCCTGGCAGGGCTGCCGCCGCATCGCCCATGGCGAAGTCTTCCTGATGAACTGGGCCGCT
CCCGACAGCATGGACGGCCGCTACTTCGGCCCGCTCGCCACGAAAACGATCATCGGCCGCGCGGTGCCGC
TGTGGACCGACGAGGACGGCGACGGCCGCTTCCAATGGCACGCCGCAACGCGGTGA
 Primer design