SecReT4
Protein ID: 148258899
T4SS name [ID]Trb [338]
Gene symbol-
Locus tagBBta_7737
StrainBradyrhizobium sp. BTAi1
Repliconchromosome [GenBank: NC_009485] [Browse all T4SS(s) in this replicon]
Location [Strand]8127755..8128528 [+]
Productsoluble lytic murein transglycosylase
Component typeTrbN
UniProt IDA5ETT4
KEGG IDbbt:BBta_7737
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 257 a.a.     [Download]
>gi|148258899|ref|YP_001243484.1| soluble lytic murein transglycosylase [Bradyrhizobium sp. BTAi1]
MVIRLISRRRSETAGRGSLARRLPALLLSGLLIAAPFTSVALAQNASTARLRSDHTIADYIAEAARRFGL
PVAWIRAVMDAESAGDVRAVSRNGAMGLMQILPDTWSELRARYGLGRDPFDPRDNILAGAAYLREMHDRY
GSPGFLAAYNAGPQRYDEYLAGVRALPAETRAYVALLAPLVGGEPLERVTAIAPDSLAWTRSPLFVVRAN
GNANAAPSQEQRAPGDNATAPRARDAAALSPRSSGLFVAQASPDPQQ
 
Nucleotide Sequence: 774 bp     [Download]
>gi|148251626|ref|NC_009485.1|:8127755-8128528 Bradyrhizobium sp. BTAi1 chromosome, complete genome
ATGGTCATCCGCTTGATCTCGCGGAGACGGAGTGAGACGGCTGGGCGGGGCTCGCTCGCCCGGCGTCTTC
CCGCTCTTCTCCTTTCCGGCCTGCTGATCGCCGCGCCCTTCACCAGCGTTGCGCTTGCGCAGAACGCGTC
TACCGCGCGTCTTCGGAGCGACCACACAATCGCTGACTACATCGCGGAAGCGGCGCGGCGTTTCGGCCTG
CCCGTCGCTTGGATACGGGCCGTCATGGACGCGGAAAGCGCCGGCGATGTGCGCGCCGTCTCTCGCAACG
GCGCGATGGGCCTGATGCAGATCTTGCCGGACACGTGGTCGGAGCTGCGCGCCCGTTACGGTCTCGGCCG
CGATCCGTTCGATCCGCGCGACAACATCCTGGCCGGCGCCGCGTACCTGCGCGAGATGCACGACCGTTAC
GGATCGCCGGGCTTCCTCGCGGCCTACAATGCGGGCCCGCAGCGTTATGACGAATACCTTGCGGGCGTGC
GCGCTCTGCCGGCCGAAACGCGTGCCTATGTCGCTTTGCTCGCGCCCCTTGTCGGCGGCGAACCGCTCGA
GCGCGTGACCGCGATTGCGCCTGATTCGCTCGCCTGGACGCGCTCTCCTTTGTTCGTCGTGCGCGCGAAC
GGCAACGCGAATGCAGCCCCATCGCAAGAACAGCGCGCGCCCGGTGACAACGCGACAGCACCACGAGCGC
GGGACGCGGCAGCGCTTTCACCGCGCTCCTCCGGCCTCTTCGTCGCGCAAGCGAGTCCGGACCCGCAGCA
ATGA
 Primer design