SecReT4
Protein ID: 148258901
T4SS name [ID]Trb [338]
Gene symbol-
Locus tagBBta_7739
StrainBradyrhizobium sp. BTAi1
Repliconchromosome [GenBank: NC_009485] [Browse all T4SS(s) in this replicon]
Location [Strand]8130541..8132526 [+]
Productconjugal transfer coupling protein TraG
Component typeTraG
UniProt IDA5ETT6
KEGG IDbbt:BBta_7739
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 2.9e-101, Aligned region: 128..557
TraG-D_C [PF12696], Evalue: 2.2e-30, Aligned region: 401..522
TrwB_AAD_bind [PF10412], Evalue: 6.4e-30, Aligned region: 171..536
AAA_10 [PF12846], Evalue: 1.3e-05, Aligned region: 372..478
Protein Sequence: 661 a.a.     [Download]
>gi|148258901|ref|YP_001243486.1| conjugal transfer coupling protein TraG [Bradyrhizobium sp. BTAi1]
MSATKILWGQILVVALIILATTWGATEWTAWRLNFQAQLGEPWFILFGWPVYYPPAFYAWWFFYDAYAPA
IFVEGAVIAASGGFMAIAVAIAMSVLRARETKNVDTYGSARWARPDEVKGAGLLGPDGVVLGKLGRDYLR
HDGPEHVLCFAPTRSGKGVGLVIPSLLTWPGSAIVHDIKGENWQLTSGFRARHGRVLLFDPTNAKSSAYN
PLLEVRRGEWEVRDVQNIADILVDPEGSLEKRNHWEKTSHALLVGAILHVLYAEEDKTLAGVASFLSDPR
RPIESTLAAMMRTPHLGEAGPHPVIASAARELLNKSDNERSGVLSTAMSFLGLYRDPVVAAVTRRCDWRI
TDIVGGAPPTTLYLVVPPSDIARTKPLIRLILNQIGRRLTEDLHAKSRRHRLLLMLDEFPALGRLDFFES
ALAFMAGYGLKSFLIAQSLNQIEKAYGPNNSILDNCHVRVSFATNDERTAKRVSDALGTATELRAMRNYA
GHRLSPWLGHLMVSRSETARPLLTPGEIMQLPPTDEIVMVAGTPPIRAKKARYFEDRRLQARILPPPVLK
AAEHHQANDWTGRPLPPQPLPEAAPPVSGMNDEDPTGSEKRRQPELSRVAPVEKKPPIDNEFEIDPNDDE
PDDAARLSRMNRLVQGLARQVSLDPDDGMEL
 
Nucleotide Sequence: 1986 bp     [Download]
>gi|148251626|ref|NC_009485.1|:8130541-8132526 Bradyrhizobium sp. BTAi1 chromosome, complete genome
ATGTCGGCAACGAAGATTCTCTGGGGTCAGATTCTGGTCGTCGCGCTGATCATCCTGGCGACGACCTGGG
GCGCCACGGAATGGACGGCGTGGCGATTGAACTTTCAGGCGCAGCTCGGTGAGCCCTGGTTCATCCTGTT
CGGCTGGCCGGTCTATTATCCCCCAGCGTTCTATGCGTGGTGGTTCTTCTACGACGCCTACGCGCCGGCG
ATCTTCGTGGAAGGGGCTGTCATCGCAGCATCGGGCGGATTCATGGCGATCGCTGTCGCGATCGCCATGT
CGGTGTTGCGGGCCCGCGAAACCAAGAACGTCGACACCTACGGTTCAGCACGATGGGCCCGCCCCGATGA
GGTGAAGGGCGCCGGCCTGCTCGGCCCCGACGGCGTCGTGCTCGGCAAGCTCGGCCGCGACTATCTCCGC
CACGACGGCCCCGAGCACGTCCTCTGCTTTGCCCCGACCAGGAGCGGCAAAGGTGTGGGTTTGGTCATTC
CCTCGCTCCTCACTTGGCCGGGGAGCGCCATCGTCCACGACATCAAGGGTGAGAACTGGCAGCTCACGTC
GGGATTTCGCGCCCGGCACGGCCGCGTGCTCCTGTTCGATCCGACGAACGCCAAGTCTTCTGCCTACAAT
CCTCTGCTCGAAGTCCGGCGCGGCGAATGGGAAGTCCGCGACGTCCAGAACATCGCCGACATCCTGGTCG
ACCCGGAAGGCTCGCTCGAGAAGAGGAACCATTGGGAGAAGACCTCTCATGCGCTGCTGGTCGGCGCCAT
CCTCCACGTGCTCTACGCCGAGGAGGACAAGACGCTCGCCGGCGTCGCCTCCTTCCTCTCCGATCCGCGC
CGACCGATCGAGTCGACGCTCGCCGCGATGATGAGGACCCCGCATCTGGGAGAGGCCGGACCGCACCCGG
TCATCGCCAGCGCCGCGCGCGAGCTCCTCAACAAGTCGGACAACGAGCGCAGCGGCGTGTTGAGCACCGC
CATGTCCTTTCTCGGCCTCTACCGCGACCCCGTCGTCGCGGCCGTCACGCGCCGCTGCGACTGGCGGATC
ACCGATATCGTCGGCGGCGCGCCGCCGACGACGCTCTACCTCGTTGTGCCGCCGTCCGACATCGCCCGCA
CCAAGCCGCTGATCCGGCTGATCCTCAACCAGATCGGCCGGCGGCTGACGGAAGATCTCCATGCGAAGTC
CCGCCGTCACCGCCTGCTTCTCATGCTCGACGAGTTCCCCGCACTCGGCCGCCTCGACTTCTTCGAGAGC
GCGCTGGCGTTCATGGCCGGCTATGGGCTGAAGTCGTTCCTGATCGCGCAGAGCCTCAACCAGATCGAGA
AGGCTTACGGCCCGAACAACTCGATCCTCGACAATTGCCATGTGCGGGTGAGCTTCGCGACCAACGACGA
GCGCACGGCCAAACGCGTGAGCGACGCGCTCGGCACGGCGACCGAGCTCCGCGCCATGCGCAACTACGCC
GGCCATCGCCTCAGCCCCTGGCTCGGACACCTGATGGTCTCGCGCTCGGAGACGGCCCGGCCGCTGCTCA
CGCCCGGCGAGATCATGCAGCTCCCGCCCACAGACGAGATCGTGATGGTCGCCGGCACGCCGCCCATCCG
CGCCAAGAAGGCGCGCTACTTCGAGGACCGGAGATTACAGGCGCGCATCTTGCCGCCGCCGGTGCTGAAG
GCGGCGGAACACCATCAAGCGAATGACTGGACCGGCAGGCCCCTGCCGCCGCAACCTTTGCCGGAAGCCG
CGCCACCCGTGAGCGGCATGAATGACGAGGATCCGACGGGCTCCGAGAAGCGGCGCCAGCCCGAGCTCAG
TCGCGTGGCCCCGGTCGAGAAGAAGCCGCCGATCGACAACGAGTTCGAGATCGACCCCAACGATGACGAG
CCGGACGATGCCGCACGGCTGAGCCGCATGAACCGTCTCGTGCAAGGCCTCGCGCGCCAGGTCTCACTCG
ATCCCGACGACGGCATGGAGCTGTAG
 Primer design