SecReT4
Protein ID: 148258903
T4SS name [ID]Trb [338]
Gene symboltrbB
Locus tagBBta_7741
StrainBradyrhizobium sp. BTAi1
Repliconchromosome [GenBank: NC_009485] [Browse all T4SS(s) in this replicon]
Location [Strand]8133137..8134120 [+]
Productconjugal transfer protein TrbB
Component typeTrbB
UniProt IDA5ETT8
KEGG IDbbt:BBta_7741
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 1.3e-86, Aligned region: 26..290
Protein Sequence: 327 a.a.     [Download]
>gi|148258903|ref|YP_001243488.1| conjugal transfer protein TrbB [Bradyrhizobium sp. BTAi1]
MAVSFQQSEAVLRGTRMLRTALGPAIAGFLEDPSIVEVMLNPDGRLWIDRLSGGLADTGERLSPADGERI
VRLVAHHVGAEVHAGSPRVSAELPGTGERFEGLLPPVVAAPAFAIRKPAVAVFTLHDYVAAGIMSAEQAE
ILRRAVADRRNILVAGGTSTGKTTLTNALLAEVSKSADRVVLIEDTRELQCAAPNLVAMRTKDGVATLSD
LVRSSLRLRPDRIPIGEVRGAEALDLLKAWGTGHPGAIGTIHAGTAIGALRRLEQLIQEAVVTVPRALIA
ETIDLVAVLSGRGASRRLAELARVEGLGPGGDYRITPATAGPAGDHA
 
Nucleotide Sequence: 984 bp     [Download]
>gi|148251626|ref|NC_009485.1|:8133137-8134120 Bradyrhizobium sp. BTAi1 chromosome, complete genome
ATGGCGGTTTCATTCCAGCAATCCGAGGCGGTCCTTCGCGGCACGCGTATGCTGCGCACGGCGCTTGGCC
CGGCCATTGCAGGCTTCCTGGAAGACCCGTCGATCGTCGAGGTGATGCTCAACCCGGACGGGCGGCTCTG
GATCGACCGGCTTTCCGGGGGTTTGGCCGATACGGGTGAGCGACTGTCGCCTGCCGACGGCGAGCGCATT
GTCAGGCTCGTCGCCCACCATGTCGGCGCCGAGGTCCACGCCGGCAGCCCGCGTGTCTCGGCCGAACTGC
CCGGAACGGGAGAGCGCTTCGAGGGCCTCCTGCCGCCTGTCGTGGCCGCGCCGGCGTTTGCGATCCGCAA
GCCCGCGGTCGCCGTGTTCACGCTGCACGACTATGTCGCCGCCGGCATCATGTCGGCCGAGCAGGCGGAG
ATTCTCCGCCGCGCCGTCGCCGACCGCCGCAATATCCTGGTCGCCGGCGGAACGAGCACCGGCAAGACCA
CGCTCACCAACGCACTGCTCGCGGAAGTCTCGAAGTCGGCCGATCGCGTCGTCCTGATCGAGGACACGCG
CGAGCTTCAATGCGCGGCGCCCAATCTCGTCGCCATGCGCACCAAGGACGGCGTCGCCACGCTCTCCGAC
CTCGTGCGCTCTTCGCTGCGCCTGCGCCCCGACCGCATTCCCATCGGCGAGGTGCGCGGCGCCGAGGCGC
TCGACCTCCTGAAGGCGTGGGGCACCGGACATCCCGGCGCCATCGGCACCATCCACGCCGGCACCGCGAT
CGGCGCGCTTCGCCGCCTCGAGCAGCTCATCCAGGAAGCCGTCGTCACGGTCCCGCGCGCGCTGATCGCA
GAAACCATCGATCTCGTCGCCGTGCTGAGCGGCCGCGGCGCCTCGCGCCGTCTCGCCGAGCTCGCCCGCG
TCGAGGGCCTCGGACCCGGCGGCGACTACCGCATCACCCCCGCGACAGCAGGCCCAGCAGGAGATCACGC
ATGA
 Primer design