SecReT4
Protein ID: 148258904
T4SS name [ID]Trb [338]
Gene symboltrbC
Locus tagBBta_7742
StrainBradyrhizobium sp. BTAi1
Repliconchromosome [GenBank: NC_009485] [Browse all T4SS(s) in this replicon]
Location [Strand]8134117..8134476 [+]
Productconjugal transfer protein TrbC
Component typeTrbC
UniProt IDA5ETT9
KEGG IDbbt:BBta_7742
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 6.3e-25, Aligned region: 23..109
Protein Sequence: 119 a.a.     [Download]
>gi|148258904|ref|YP_001243489.1| conjugal transfer protein TrbC [Bradyrhizobium sp. BTAi1]
MTAARQPSTKHRLFVGSVLDRIGAIGLTATGLLYAAPAYASGSSMPWEQPLQQILQSIEGPVAKVIAVII
IIVTGLTLAFGDTSGGFRRLVQIVFGLSIAFAASSFFLSFFNFGGGAVV
 
Nucleotide Sequence: 360 bp     [Download]
>gi|148251626|ref|NC_009485.1|:8134117-8134476 Bradyrhizobium sp. BTAi1 chromosome, complete genome
ATGACCGCCGCCCGACAGCCATCAACTAAGCATCGCCTATTCGTCGGCTCGGTTCTCGACCGGATCGGCG
CCATCGGTCTGACCGCGACAGGGCTTCTCTACGCGGCGCCGGCCTATGCCAGCGGCTCGTCCATGCCGTG
GGAGCAGCCGCTTCAGCAGATCCTGCAATCGATCGAAGGCCCGGTGGCCAAGGTCATCGCGGTGATCATC
ATCATCGTCACTGGCCTGACGCTCGCCTTCGGCGATACGAGCGGCGGCTTCCGCAGGCTCGTGCAGATCG
TCTTTGGCCTGTCGATCGCATTCGCAGCCAGCTCCTTCTTCCTGAGCTTCTTCAACTTCGGCGGTGGGGC
GGTGGTGTGA
 Primer design