SecReT4
Protein ID: 148258905
T4SS name [ID]Trb [338]
Gene symbol-
Locus tagBBta_7743
StrainBradyrhizobium sp. BTAi1
Repliconchromosome [GenBank: NC_009485] [Browse all T4SS(s) in this replicon]
Location [Strand]8134254..8134754 [+]
Productconjugal transfer protein TrbD
Component typeTrbD
UniProt IDA5ETU0
KEGG IDbbt:BBta_7743
PDB IDNA
Domain hit(s) vs Pfam VirB3 [PF05101], Evalue: 8.3e-11, Aligned region: 89..158
Protein Sequence: 166 a.a.     [Download]
>gi|148258905|ref|YP_001243490.1| conjugal transfer protein TrbD [Bradyrhizobium sp. BTAi1]
MGAAASADPAIDRRPGGQGHRGDHHHRHWPDARLRRYERRLPQARADRLWPVDRIRSQLLLPELLQLRRW
GGGVMAGVLETAEVPGFSVPVHRALTEPILLGGAPRSIAILNGTLAAALGLGLRLWLVGLGLWAVGHFAA
VWAAKRDPMFVEVTRRHLRIPGFLGV
 
Nucleotide Sequence: 501 bp     [Download]
>gi|148251626|ref|NC_009485.1|:8134254-8134754 Bradyrhizobium sp. BTAi1 chromosome, complete genome
GTGGGAGCAGCCGCTTCAGCAGATCCTGCAATCGATCGAAGGCCCGGTGGCCAAGGTCATCGCGGTGATC
ATCATCATCGTCACTGGCCTGACGCTCGCCTTCGGCGATACGAGCGGCGGCTTCCGCAGGCTCGTGCAGA
TCGTCTTTGGCCTGTCGATCGCATTCGCAGCCAGCTCCTTCTTCCTGAGCTTCTTCAACTTCGGCGGTGG
GGCGGTGGTGTGATGGCTGGTGTGCTTGAGACCGCCGAGGTCCCCGGCTTCTCGGTGCCAGTCCATCGGG
CGCTGACCGAGCCCATCCTCCTCGGCGGCGCGCCGCGCTCGATCGCCATCCTCAACGGCACGCTCGCCGC
CGCGCTCGGGCTCGGCCTGCGGCTCTGGCTCGTCGGCCTCGGCCTTTGGGCCGTCGGCCATTTCGCGGCG
GTGTGGGCGGCGAAGCGCGATCCGATGTTCGTGGAGGTCACGCGCCGGCACCTGCGCATTCCCGGCTTCC
TGGGCGTGTGA
 Primer design