SecReT4
Protein ID: 148258906
T4SS name [ID]Trb [338]
Gene symboltrbE
Locus tagBBta_7744
StrainBradyrhizobium sp. BTAi1
Repliconchromosome [GenBank: NC_009485] [Browse all T4SS(s) in this replicon]
Location [Strand]8134763..8137201 [+]
Productconjugal transfer ATPase TrbE
Component typeTrbE
UniProt IDA5ETU1
KEGG IDbbt:BBta_7744
PDB IDNA
Domain hit(s) vs Pfam AAA_10 [PF12846], Evalue: 1.8e-34, Aligned region: 442..723
CagE_TrbE_VirB [PF03135], Evalue: 1.7e-13, Aligned region: 182..388
Protein Sequence: 812 a.a.     [Download]
>gi|148258906|ref|YP_001243491.1| conjugal transfer ATPase TrbE [Bradyrhizobium sp. BTAi1]
MMNLAEYRRTSSRLADFLPWAALAAEGVVLNKDGSFQRTARFRGPDLDSSVPAELVAVAGRLNNAFRRLG
SGWAIFVEAQRHGVGAYPSSRFPDAASALVDAERKADFEEASAHFESSYFLTFTYLPPAEDAARAENWLY
EGKADRGVDPHEILSGFVDRTDRVLQLIEAFMPECAWLDDGETLTYLHSCISTRRHRVRVPETPIYLDAL
LADQPLTGGLEPRLGDAHLRVLTIVSFPTATTPGILDELNRLAFPYRWATRAILLDKTDATRLLTKIRRQ
WFAKRKSIAAILKEVMTNEASALVDTDAANKAADADLALQELGADYAGEAYVTATVTVWDDDPRIAAEKL
RLVEKAIQGRDFTAMPETINAVDAWLGSLPGHVYANVRQPPISTLNLAHMIPLSAVWAGPERDEHFGAPT
LLFGKTEGSTPFRFSLHVGDVGHTLVVGPTGAGKSVLLALMALQFRRYSRSQVFAFDFGGSIRAAALAMG
GDWHDLGGGLTDGSAESVSLQPLAGIHHVPERAWAADWIVAILMREGVAITPEVKEHLWTALTSLASAPV
VERTITGLAVLLQSNDLKQALRPFCVGGAYGRLLDAEHEHLGEASVQAFETEGLIGTGAAPAVLAYLFHR
IEDRLDGRPTLLIVDEGWLALDDEGFAGQLREWLKTLRKKNASVVFATQSLSDIDNSPIAPAIIESCPTR
VLLPNERAIEPQITAIYRRFGLNDRQIEILARAMPKRDYYCQSRRGNRLFELGLSDVALALCAASSKADQ
AAIERIVAEHGRENFLPAWLHLRGVAWAADLIPNLTNLETQS
 
Nucleotide Sequence: 2439 bp     [Download]
>gi|148251626|ref|NC_009485.1|:8134763-8137201 Bradyrhizobium sp. BTAi1 chromosome, complete genome
ATGATGAACCTCGCCGAATATCGCCGCACGTCTTCGCGCCTCGCCGACTTCCTGCCGTGGGCAGCGCTCG
CCGCAGAGGGCGTCGTCCTCAACAAGGACGGCAGCTTCCAGCGCACGGCACGCTTCCGCGGCCCCGACCT
CGACTCCTCCGTGCCGGCCGAGCTGGTCGCCGTCGCGGGCCGCCTCAACAACGCCTTCCGGCGCCTCGGC
TCCGGCTGGGCGATCTTCGTCGAGGCGCAGCGTCACGGCGTCGGCGCCTATCCGTCGAGCCGCTTTCCCG
ATGCCGCGTCTGCGCTGGTCGACGCCGAGCGCAAGGCGGACTTCGAGGAAGCGAGTGCGCATTTCGAGTC
GAGCTACTTCCTCACCTTCACCTACCTGCCGCCGGCCGAGGACGCCGCGCGCGCCGAGAACTGGCTCTAC
GAGGGCAAGGCCGACCGCGGCGTCGATCCGCACGAGATCCTAAGCGGCTTCGTCGACCGCACGGATCGCG
TCCTGCAGCTCATCGAAGCCTTCATGCCCGAATGCGCCTGGCTCGATGACGGCGAGACGCTGACCTACCT
GCATTCCTGCATCTCGACCAGGCGCCATCGCGTGCGCGTGCCCGAGACGCCGATATATCTCGACGCGTTA
TTGGCCGACCAGCCGCTGACGGGAGGCCTCGAGCCGCGGCTCGGCGACGCACACCTTCGCGTGCTCACGA
TCGTCAGTTTTCCGACGGCAACCACGCCGGGCATTTTGGATGAGCTGAACCGGCTGGCGTTTCCTTATCG
CTGGGCGACGCGCGCGATCCTGCTCGACAAGACCGACGCAACCAGGCTGCTGACCAAGATCCGCCGGCAA
TGGTTCGCCAAGCGCAAGAGCATCGCGGCGATCCTGAAGGAGGTAATGACCAACGAGGCCTCGGCTCTCG
TCGACACCGATGCCGCGAACAAGGCGGCCGACGCCGACCTCGCGCTCCAGGAGCTCGGCGCCGACTACGC
CGGCGAGGCCTATGTCACCGCGACGGTGACGGTCTGGGACGATGACCCCCGCATCGCCGCCGAAAAGCTG
CGGCTGGTCGAGAAGGCCATCCAGGGCCGCGACTTCACCGCGATGCCCGAGACGATCAATGCCGTGGACG
CCTGGCTCGGCTCGCTGCCGGGGCATGTCTACGCCAACGTGCGCCAGCCGCCGATCTCGACCCTCAACCT
CGCCCACATGATCCCGCTGTCGGCGGTGTGGGCGGGGCCGGAACGGGATGAGCACTTCGGTGCACCCACC
TTGCTGTTCGGCAAGACCGAAGGGTCCACCCCGTTCCGGTTCTCTTTGCATGTTGGTGACGTCGGTCACA
CGCTCGTCGTCGGCCCGACCGGCGCCGGCAAGTCGGTGCTGCTGGCGCTGATGGCCCTTCAGTTCCGGCG
CTATTCCCGCTCGCAGGTCTTCGCCTTCGACTTTGGCGGTTCGATCCGCGCCGCCGCGCTCGCCATGGGC
GGCGACTGGCACGACCTCGGCGGCGGTCTCACGGACGGGTCCGCCGAGAGCGTTTCGCTGCAGCCGCTCG
CCGGCATCCACCATGTCCCCGAACGCGCCTGGGCCGCCGACTGGATCGTCGCGATCCTGATGCGCGAGGG
CGTGGCGATCACACCCGAGGTCAAGGAGCATCTCTGGACCGCGCTGACCTCTCTTGCCAGCGCTCCCGTC
GTCGAACGCACGATCACCGGCCTCGCGGTGCTCCTGCAATCAAACGATCTCAAGCAGGCGCTGCGGCCCT
TTTGTGTCGGCGGGGCCTATGGCCGCCTGCTCGACGCCGAGCACGAGCATCTCGGCGAGGCATCGGTCCA
GGCCTTCGAGACCGAGGGCCTGATCGGCACCGGCGCGGCGCCGGCCGTGCTCGCCTATCTGTTTCACCGC
ATCGAGGATCGCCTCGACGGGCGGCCGACCTTGCTGATCGTCGACGAAGGCTGGCTGGCGCTCGACGACG
AAGGCTTCGCGGGCCAGCTCCGGGAGTGGCTGAAGACGCTCCGAAAGAAGAACGCCAGCGTCGTCTTCGC
CACGCAGTCGCTTTCCGACATCGACAATTCACCGATCGCGCCGGCCATCATCGAGAGCTGCCCGACGCGA
GTGCTGCTCCCGAACGAGCGGGCGATCGAGCCGCAGATCACTGCGATCTACCGCAGGTTCGGGTTAAACG
ATCGCCAGATCGAAATCCTCGCGCGCGCGATGCCGAAGCGCGACTACTACTGCCAGTCGCGACGCGGCAA
CAGGCTCTTCGAACTCGGCCTCTCCGACGTCGCTCTCGCCCTGTGCGCCGCGTCCTCCAAGGCCGATCAA
GCCGCCATCGAGCGCATCGTCGCCGAACATGGCCGTGAGAATTTCCTGCCGGCATGGCTGCACCTGCGCG
GCGTCGCGTGGGCCGCCGATCTCATCCCAAACCTCACCAACCTGGAGACACAATCATGA
 Primer design