SecReT4
Protein ID: 148258907
T4SS name [ID]Trb [338]
Gene symbol-
Locus tagBBta_7745
StrainBradyrhizobium sp. BTAi1
Repliconchromosome [GenBank: NC_009485] [Browse all T4SS(s) in this replicon]
Location [Strand]8137198..8137962 [+]
Productconjugal transfer protein TrbJ
Component typeTrbJ
UniProt IDA5ETU2
KEGG IDbbt:BBta_7745
PDB IDNA
Domain hit(s) vs Pfam DUF4141 [PF13605], Evalue: 2.5e-06, Aligned region: 25..51
Protein Sequence: 254 a.a.     [Download]
>gi|148258907|ref|YP_001243492.1| conjugal transfer protein TrbJ [Bradyrhizobium sp. BTAi1]
MIVRRSRAALLAATALSLPLWFSPVLVAPAAAQWIVYDPTNYAQNVLQAARALQQINNQITSLQNEAQML
INQARNLASLPYSSLQRLHQSVQRTQQLLGQAQNIAFDVQQVDRAFQTTYGNASLSASDQQLIADARTRW
QNTVGGLQDAMRVQAGVVGNIDTNRTEMSALVGQSQGATGALQATQAGNQILALQAQQLADLTAVVAADG
RARALADAERAAAAEQGREQRRRFLTPGAGYQAGNARMFPNSGK
 
Nucleotide Sequence: 765 bp     [Download]
>gi|148251626|ref|NC_009485.1|:8137198-8137962 Bradyrhizobium sp. BTAi1 chromosome, complete genome
ATGATTGTCCGTCGTTCCCGCGCGGCGCTTCTTGCCGCGACGGCTCTTTCACTTCCGCTTTGGTTTTCGC
CGGTCCTGGTCGCGCCTGCCGCAGCCCAGTGGATCGTCTACGACCCGACCAACTATGCGCAGAACGTGCT
GCAGGCGGCGCGCGCGCTGCAGCAGATCAACAACCAGATCACCTCGCTCCAGAACGAAGCGCAGATGCTA
ATCAACCAGGCGCGCAATCTCGCGAGCTTGCCGTATTCCTCGTTGCAGCGTCTCCATCAGTCCGTCCAGC
GCACCCAGCAGCTTCTCGGCCAGGCGCAGAACATCGCCTTCGACGTGCAGCAGGTCGACCGCGCGTTCCA
GACCACTTATGGCAACGCGTCACTCTCGGCATCGGATCAGCAATTGATCGCGGATGCGCGCACGCGCTGG
CAGAATACGGTCGGCGGACTTCAGGACGCGATGCGCGTCCAGGCCGGTGTGGTCGGCAACATCGACACAA
ACCGCACGGAGATGTCGGCGCTGGTCGGCCAGAGCCAAGGCGCCACGGGCGCGCTGCAAGCAACACAGGC
TGGCAACCAGATCCTCGCACTCCAAGCGCAACAACTCGCCGACTTGACTGCTGTCGTGGCAGCCGATGGG
CGAGCACGGGCTCTCGCCGATGCCGAGCGCGCGGCCGCGGCCGAGCAAGGACGTGAACAGCGCCGGCGCT
TCCTGACGCCCGGCGCCGGTTATCAGGCCGGAAACGCCCGCATGTTCCCGAATAGCGGCAAATGA
 Primer design