SecReT4
Protein ID: 148258908
T4SS name [ID]Trb [338]
Gene symbol-
Locus tagBBta_7746
StrainBradyrhizobium sp. BTAi1
Repliconchromosome [GenBank: NC_009485] [Browse all T4SS(s) in this replicon]
Location [Strand]8137959..8138309 [+]
Producthypothetical protein
Component typeTrbK
UniProt IDA5ETU3
KEGG IDbbt:BBta_7746
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 116 a.a.     [Download]
>gi|148258908|ref|YP_001243493.1| hypothetical protein BBta_7746 [Bradyrhizobium sp. BTAi1]
MRARPVDAKTLARIGAVAFVAVAITATVIELTRKVERPETTPARQAEVGAADPLRDELFRCQSLGEAGPR
DRACLRAWAESRRRFLMPRTTPSTSPSDASRPTGETRGEGAAPNGE
 
Nucleotide Sequence: 351 bp     [Download]
>gi|148251626|ref|NC_009485.1|:8137959-8138309 Bradyrhizobium sp. BTAi1 chromosome, complete genome
ATGAGGGCGCGTCCCGTGGACGCCAAGACTCTCGCCCGAATCGGAGCTGTCGCGTTCGTCGCCGTCGCGA
TCACCGCGACGGTCATCGAGCTGACCCGGAAAGTGGAGCGGCCTGAAACCACTCCAGCCCGGCAAGCGGA
GGTGGGTGCGGCCGACCCGCTGCGAGACGAGTTGTTCCGATGCCAGAGCCTCGGCGAGGCCGGGCCGCGC
GATCGGGCATGCCTCCGCGCCTGGGCGGAGAGCCGCCGACGATTTCTGATGCCGCGGACAACACCTTCGA
CGAGCCCGTCGGATGCGAGCCGGCCCACCGGCGAGACGCGCGGCGAAGGCGCCGCGCCGAACGGCGAGTA
G
 Primer design