SecReT4
Protein ID: 148258909
T4SS name [ID]Trb [338]
Gene symbol-
Locus tagBBta_7747
StrainBradyrhizobium sp. BTAi1
Repliconchromosome [GenBank: NC_009485] [Browse all T4SS(s) in this replicon]
Location [Strand]8138314..8139663 [+]
Productconjugal transfer protein TrbL
Component typeTrbL
UniProt IDA5ETU4
KEGG IDbbt:BBta_7747
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 1.9e-53, Aligned region: 37..262
Protein Sequence: 449 a.a.     [Download]
>gi|148258909|ref|YP_001243494.1| conjugal transfer protein TrbL [Bradyrhizobium sp. BTAi1]
MGGTGVIDHFLEVFTRYIDSGFGLLGGEVAFVATTLIVIDVTIAALFWSWGADDDILARLIKKTLFVGVF
AYLIGNWNNLARIVFESFAGLGLKASGTGFTTADLLRPGRVAQTGLDAGRPLLDSISGLMGYWSFFENFI
QIACLFLAWALVLLAFFILAVQLFVTLIEFKLTTLAGFVLIPFGLFGQSAFMAERVLGNVISSGIKVLVL
AVIIGIGSTLFSEFTAGFGGASPTIDQAMAIVLAALSLLGLGIFGPGIANGLVSSGPQLSAGAAVGTGLA
AGGAVVAAGAAGGLALRGGAAAISGTAAAARGGATLAGGAATAYSLGAAGQSGPAGVASGLGGVARAAGG
AAISPLRRAVSHAADSMRSSYARGAQSAFEATGGASTMGTIGGAVNASGAPVSDGPPAWARRMKRSQQLH
HGVMAAAHAIRSGDSHGGGSSVNLSQRDQ
 
Nucleotide Sequence: 1350 bp     [Download]
>gi|148251626|ref|NC_009485.1|:8138314-8139663 Bradyrhizobium sp. BTAi1 chromosome, complete genome
ATGGGCGGCACTGGCGTCATCGACCATTTTCTCGAGGTATTTACTCGATACATCGACTCCGGTTTCGGCT
TGCTCGGCGGCGAAGTCGCGTTCGTTGCGACGACGCTGATCGTGATCGACGTCACGATCGCCGCTCTGTT
CTGGAGCTGGGGCGCCGATGACGACATCCTCGCCCGCCTCATCAAGAAGACGCTGTTCGTCGGCGTGTTC
GCCTATCTCATCGGCAACTGGAACAACCTCGCGCGCATCGTCTTCGAGTCCTTCGCCGGCCTCGGACTGA
AGGCGAGCGGAACCGGCTTCACGACGGCTGATCTGCTCCGCCCGGGCCGCGTCGCGCAGACCGGCCTCGA
TGCCGGCCGTCCGCTGCTCGACTCGATCTCGGGCCTCATGGGCTACTGGTCGTTCTTCGAAAACTTCATC
CAGATCGCCTGCCTGTTCCTCGCCTGGGCGCTCGTCCTGCTCGCGTTCTTCATCCTCGCGGTGCAGCTCT
TCGTGACTCTCATCGAGTTCAAGCTGACCACGCTCGCGGGCTTCGTCCTCATCCCGTTCGGGCTGTTCGG
GCAGAGCGCGTTCATGGCCGAGCGCGTGCTCGGCAACGTCATCAGCTCCGGCATCAAGGTGCTGGTGCTC
GCCGTCATCATCGGCATCGGCTCGACGCTGTTCTCCGAGTTCACCGCCGGCTTCGGCGGCGCCAGCCCGA
CGATAGATCAGGCCATGGCGATCGTGCTCGCGGCGCTCTCGCTTCTCGGCCTCGGGATCTTCGGGCCCGG
CATCGCCAACGGCCTCGTCAGCAGCGGCCCGCAGCTCAGCGCCGGCGCGGCCGTGGGCACCGGCCTTGCC
GCCGGCGGCGCGGTGGTCGCAGCGGGTGCCGCCGGCGGTCTCGCTTTGCGCGGCGGCGCGGCCGCGATCT
CGGGCACCGCCGCGGCAGCGCGCGGAGGCGCGACCCTCGCGGGCGGCGCGGCGACCGCTTACAGCCTCGG
GGCGGCCGGACAATCCGGTCCGGCCGGCGTTGCCTCCGGCCTCGGCGGTGTCGCACGGGCGGCTGGAGGC
GCGGCCATCTCGCCGCTTCGCCGCGCGGTCTCTCACGCGGCCGACAGCATGCGCTCCAGCTACGCCCGAG
GCGCCCAGTCCGCTTTCGAGGCGACCGGCGGCGCTTCAACGATGGGCACCATCGGCGGCGCGGTCAACGC
GTCAGGAGCTCCCGTGTCTGACGGTCCGCCCGCCTGGGCCCGCCGCATGAAGCGCTCCCAGCAGCTCCAT
CACGGCGTCATGGCCGCCGCGCACGCGATCCGCAGCGGCGACAGCCATGGCGGCGGCAGCTCCGTTAACC
TTTCCCAGCGAGACCAATAA
 Primer design