SecReT4
Protein ID: 148258910
T4SS name [ID]Trb [338]
Gene symbol-
Locus tagBBta_7748
StrainBradyrhizobium sp. BTAi1
Repliconchromosome [GenBank: NC_009485] [Browse all T4SS(s) in this replicon]
Location [Strand]8139663..8140343 [+]
Productconjugal transfer protein TrbF
Component typeTrbF
UniProt IDA5ETU5
KEGG IDbbt:BBta_7748
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 3.5e-62, Aligned region: 21..224
Protein Sequence: 226 a.a.     [Download]
>gi|148258910|ref|YP_001243495.1| conjugal transfer protein TrbF [Bradyrhizobium sp. BTAi1]
MFKRPSTHYGKTPEPETPYQRAAQVWDERIGSARVQARNWRLMAFSSLALSAAFAGALVWQSARGTVVPW
VVQVDNLGQAQAVAPAVADYRPTDPQIAFHLARFIEQVRSIPADPIVVRQNWLRAYDFTTDRGAAALNDY
ARANDPFTKVGKQQVAVDVSSVIRASPDSFRVAWTERRYENGQLASTERWTAILTIVVQPPRDAERLRAN
PLGIYVNAINWSRELG
 
Nucleotide Sequence: 681 bp     [Download]
>gi|148251626|ref|NC_009485.1|:8139663-8140343 Bradyrhizobium sp. BTAi1 chromosome, complete genome
ATGTTCAAGCGACCTTCGACGCATTACGGCAAGACACCTGAGCCCGAGACGCCCTATCAGCGCGCCGCGC
AGGTCTGGGACGAGCGCATCGGCTCGGCCCGCGTGCAGGCCCGAAACTGGCGGCTGATGGCTTTCAGTTC
GCTCGCGCTGTCGGCCGCCTTCGCCGGTGCGCTGGTTTGGCAATCGGCGCGGGGCACCGTCGTCCCTTGG
GTCGTGCAGGTCGATAATCTCGGCCAAGCCCAGGCAGTCGCACCTGCGGTCGCCGATTATCGCCCGACCG
ATCCTCAGATCGCGTTCCATCTCGCGCGCTTCATCGAGCAGGTCCGCTCGATCCCGGCCGATCCGATCGT
GGTTCGGCAGAATTGGCTGCGCGCCTACGACTTCACGACCGACCGTGGCGCTGCGGCTCTGAACGACTAC
GCACGCGCCAACGACCCTTTCACCAAAGTGGGCAAGCAACAGGTCGCGGTCGACGTTTCGAGCGTCATTC
GAGCGTCGCCCGACAGCTTCCGCGTGGCCTGGACCGAGCGGCGCTATGAGAACGGCCAGCTCGCATCGAC
CGAACGTTGGACCGCCATCCTCACCATCGTGGTGCAGCCGCCGCGTGACGCAGAGCGGCTGCGCGCCAAT
CCGCTCGGCATCTACGTCAATGCGATCAACTGGTCGCGGGAGCTGGGGTAA
 Primer design