SecReT4
Protein ID: 148258911
T4SS name [ID]Trb [338]
Gene symbol-
Locus tagBBta_7749
StrainBradyrhizobium sp. BTAi1
Repliconchromosome [GenBank: NC_009485] [Browse all T4SS(s) in this replicon]
Location [Strand]8140425..8141321 [+]
Productconjugal transfer protein TrbG
Component typeTrbG
UniProt IDA5ETU6
KEGG IDbbt:BBta_7749
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 1.2e-61, Aligned region: 76..292
Protein Sequence: 298 a.a.     [Download]
>gi|148258911|ref|YP_001243496.1| conjugal transfer protein TrbG [Bradyrhizobium sp. BTAi1]
MSACATQRPPQISYDSDVPPLPAVPAAIADERPRPLHIPPAWTPSHGGAAANSPTARVANANAAARVEPR
REGYYNAIQIYPWSEGALYQVYTSPGQITDIALEPGESLTGAGPIAAGDTARWIIGDTESGSGITRRVHV
LVKPTRPDITTNLVITTDRRSYMIELRAGANPYMPAVAWAYPQLPASQRAGVPATPVIPAAAARNYRYAL
SGDNPPWRPIAIYDDGRRVYVEFPRGIVQGEMPPLFVIGSEGELQIANSRIYQNVLIVDRLFGAAELRLG
SGDRQQKIRISRSDGRPS
 
Nucleotide Sequence: 897 bp     [Download]
>gi|148251626|ref|NC_009485.1|:8140425-8141321 Bradyrhizobium sp. BTAi1 chromosome, complete genome
CTGAGCGCATGCGCCACGCAGAGGCCGCCGCAGATCAGCTATGACTCCGATGTCCCGCCATTGCCGGCCG
TTCCAGCGGCAATCGCGGACGAGCGGCCGCGACCGCTGCACATTCCGCCCGCTTGGACTCCCAGCCATGG
CGGGGCCGCCGCCAATTCGCCGACGGCGCGGGTGGCGAACGCCAATGCCGCCGCCCGCGTCGAGCCTCGC
CGAGAGGGCTACTACAACGCCATCCAGATTTATCCATGGTCGGAAGGCGCGCTCTATCAGGTCTACACCT
CGCCGGGACAGATCACGGACATCGCGCTTGAGCCTGGCGAGAGCCTGACCGGCGCCGGCCCGATCGCCGC
CGGCGACACCGCGCGCTGGATCATCGGCGACACCGAAAGCGGATCGGGGATCACGCGCCGTGTCCACGTG
CTAGTAAAGCCGACGCGGCCCGACATCACCACCAACCTTGTCATCACCACCGATCGCCGCAGCTACATGA
TCGAGCTGCGGGCCGGCGCCAATCCGTACATGCCGGCCGTGGCATGGGCCTATCCACAACTTCCCGCTTC
GCAGCGTGCGGGTGTCCCGGCGACGCCGGTCATCCCCGCCGCCGCGGCGCGCAACTATCGCTACGCTTTG
AGCGGCGACAATCCGCCTTGGCGACCAATCGCCATCTATGACGATGGACGGCGGGTTTATGTCGAGTTCC
CGCGCGGCATCGTTCAGGGCGAGATGCCGCCGCTCTTCGTCATCGGCTCGGAAGGCGAGCTCCAGATCGC
CAACAGCCGCATCTACCAGAACGTCCTAATCGTCGATCGCCTCTTCGGCGCCGCCGAGCTTCGCCTTGGC
AGCGGTGACCGCCAGCAAAAGATCAGGATCTCGCGCAGCGACGGGAGGCCATCGTAA
 Primer design