SecReT4
Protein ID: 148258912
T4SS name [ID]Trb [338]
Gene symbol-
Locus tagBBta_7750
StrainBradyrhizobium sp. BTAi1
Repliconchromosome [GenBank: NC_009485] [Browse all T4SS(s) in this replicon]
Location [Strand]8141321..8142520 [+]
Productconjugal transfer protein TrbI
Component typeTrbI
UniProt IDA5ETU7
KEGG IDbbt:BBta_7750
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 5.2e-60, Aligned region: 216..394
Protein Sequence: 399 a.a.     [Download]
>gi|148258912|ref|YP_001243497.1| conjugal transfer protein TrbI [Bradyrhizobium sp. BTAi1]
MTSSDNPDRLETEQGPRDSAAPMRLRGDPPRVTRLSRKALAGIGLVASIGLGGALIYALQTRDAGPRNEE
LYSTTNRPTADGLAGLPRDYTGPRLGPPLPGDLGRPILSAQDRGQPVVPPTIQPTVDAAEQRRLAEQEAA
RTSRVFFQTEARALAASPAPGGAATNTNLSGLGLPGQFNMPTAQERAQDRQLAFLNAAADRRTVAPDRVM
PPASPYVLQAGAVIPAALITGIRSDLPGQITAQVTENIYDSPTGRLLLVPQGTRIIGQYDNAVQFGQRRV
LLVWNRLILPNGRSIVLERQPGADAAGYAGLEDGVDYHWWDLAKAAGLSTLLSVGTELAIDDDDRLLRAI
RNGGQDTINDAGQEIIRRQLNVAPTLTIRPGFPVRVIVTRDLVLEPYRG
 
Nucleotide Sequence: 1200 bp     [Download]
>gi|148251626|ref|NC_009485.1|:8141321-8142520 Bradyrhizobium sp. BTAi1 chromosome, complete genome
ATGACCAGCTCTGACAATCCTGACCGCCTTGAGACAGAACAAGGTCCGCGTGACTCCGCGGCGCCTATGC
GTCTGCGCGGCGACCCGCCCCGCGTCACCCGATTGTCCCGCAAGGCGTTGGCGGGGATCGGCCTGGTCGC
GTCGATCGGCCTCGGCGGCGCCCTGATCTACGCGCTGCAAACCCGCGATGCCGGCCCCCGCAACGAGGAA
CTCTATTCCACCACCAACCGGCCCACGGCCGATGGACTCGCCGGGCTGCCGCGCGACTATACCGGCCCGC
GGCTTGGACCACCGCTGCCGGGCGACCTGGGCCGCCCCATCCTGAGCGCGCAAGATCGCGGACAGCCGGT
CGTCCCCCCGACGATCCAGCCGACCGTGGATGCCGCGGAGCAGCGTCGCCTCGCCGAGCAGGAAGCTGCG
CGCACGAGCCGCGTCTTCTTCCAGACCGAGGCGCGGGCGCTTGCCGCTTCGCCTGCACCTGGCGGCGCCG
CCACCAACACGAACCTGTCCGGCCTCGGGCTTCCCGGCCAGTTCAACATGCCGACGGCGCAAGAACGCGC
GCAGGATCGGCAACTGGCCTTCCTCAACGCCGCTGCCGATCGCCGCACTGTCGCTCCGGATCGTGTGATG
CCGCCGGCCTCGCCCTACGTGCTGCAAGCCGGGGCGGTGATCCCGGCCGCCTTGATCACCGGCATTCGCT
CCGATCTTCCCGGACAGATCACCGCCCAGGTGACCGAAAACATCTACGACAGTCCGACCGGCAGACTACT
TCTGGTGCCGCAAGGCACCCGGATCATCGGCCAGTACGACAATGCCGTGCAATTCGGCCAACGCAGGGTG
TTGTTGGTGTGGAATCGCCTAATCCTGCCGAACGGCCGGTCAATCGTCCTGGAGCGCCAGCCAGGCGCGG
ATGCGGCCGGATACGCCGGCCTCGAGGACGGTGTCGACTACCATTGGTGGGACCTCGCCAAAGCCGCTGG
CCTTTCCACGCTCCTGAGCGTCGGCACCGAGCTCGCGATCGACGACGATGACCGCTTGCTGCGCGCCATC
CGCAACGGTGGCCAGGATACAATCAACGATGCCGGCCAGGAAATCATCCGCCGGCAGCTCAACGTCGCGC
CGACGCTCACCATCCGGCCTGGCTTTCCGGTCCGCGTGATCGTCACCCGCGATCTCGTGCTCGAACCCTA
TCGAGGATAG
 Primer design