SecReT4
Protein ID: 148284000
T4SS name [ID]VirB [506]
Gene symbolvirB8
Locus tagOTBS_0003
StrainOrientia tsutsugamushi str. Boryong
Repliconchromosome [GenBank: NC_009488] [Browse all T4SS(s) in this replicon]
Location [Strand]2998..3678 [+]
Producttype IV secretion system protein
Component typeVirB8
UniProt IDA5CBW5
KEGG IDots:OTBS_0003
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 3.4e-43, Aligned region: 20..224
Protein Sequence: 226 a.a.     [Download]
>gi|148284000|ref|YP_001248090.1| type IV secretion system protein [Orientia tsutsugamushi str. Boryong]
MFFWKNKKKVEQQKQNKPAIKSWFNDHYETVLVQRNIAVLLSFICIILIFIAVVAVMKISLARNFEPFVI
QIEEKTGATRVVNPVGIEVLNTEKALAQYFIKLYISARETYNPVDFEIKARQTIKLLSNNNVYWSYLNFI
NRKENDPRLIYGQRETTTLKVRSWSELPDRRFIVRIAIHESISGKVFNKIVVVQYQYVPMELSPEEFDIN
PVGFQIIGYRIDDDYS
 
Nucleotide Sequence: 681 bp     [Download]
>gi|148283997|ref|NC_009488.1|:2998-3678 Orientia tsutsugamushi str. Boryong, complete genome
ATGTTTTTTTGGAAAAATAAAAAGAAAGTTGAACAGCAAAAGCAAAATAAGCCTGCTATAAAAAGTTGGT
TTAATGATCATTATGAAACTGTTTTGGTACAGCGTAACATTGCTGTATTGTTATCATTTATATGTATAAT
ATTAATTTTTATAGCAGTAGTTGCTGTGATGAAAATATCTTTAGCAAGAAATTTTGAACCATTTGTAATA
CAGATTGAAGAAAAAACTGGGGCAACCAGGGTTGTTAATCCAGTTGGAATTGAAGTATTAAATACTGAAA
AAGCGTTAGCGCAATATTTTATTAAGTTATATATTTCTGCTAGGGAAACATATAATCCAGTAGATTTTGA
GATTAAAGCTAGACAAACTATTAAATTATTGTCTAATAACAATGTTTATTGGTCATATTTGAATTTTATT
AATCGAAAGGAAAATGATCCAAGGTTAATATATGGGCAACGTGAAACTACAACATTAAAGGTTAGATCAT
GGTCAGAGTTGCCTGACAGAAGGTTTATTGTTCGAATTGCAATACATGAATCTATAAGCGGAAAGGTATT
TAATAAGATTGTTGTAGTACAGTATCAATATGTTCCTATGGAACTTTCTCCTGAAGAATTTGATATTAAT
CCAGTAGGTTTTCAAATTATAGGATATAGAATAGATGATGATTATAGTTAG
 Primer design