SecReT4
Protein ID: 148284003
T4SS name [ID]VirB [506]
Gene symbolvirB11
Locus tagOTBS_0006
StrainOrientia tsutsugamushi str. Boryong
Repliconchromosome [GenBank: NC_009488] [Browse all T4SS(s) in this replicon]
Location [Strand]5628..6617 [+]
Producttype IV secretion system ATPase VirB11
Component typeVirB11
UniProt IDA5CBW8
KEGG IDots:OTBS_0006
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 6.4e-90, Aligned region: 12..310
Protein Sequence: 329 a.a.     [Download]
>gi|148284003|ref|YP_001248093.1| type IV secretion system ATPase VirB11 [Orientia tsutsugamushi str. Boryong]
MKNNIALETYLTPFKLIFDEAGVNEVMINRPGEVWVEKKGSYRQELMKDLDFSHLAALARLIAQSTEQVI
SEEKPLLSATLPNGYRVQVVFPPACEVGSIGIAIRKVSSLNMTLEDYNKTGAFDYTAIDEVIDENDKILS
EYLINKQFKNFLQHAIKSKKNIIISGGTSSGKTTFTNSALLEVPHTERLITVEDAREISIPNHPNRLHLL
ASKGNQGRAKVTTQDLIEACLRLRPDRIIIGELRGAEAFSFLRAINTGHPGSISTLHADTTAMALEQLKL
MVMQAGLGMPPDEIKNYINAVIDIVVQLKRGDRGIRYISEIYFKKMRKK
 
Nucleotide Sequence: 990 bp     [Download]
>gi|148283997|ref|NC_009488.1|:5628-6617 Orientia tsutsugamushi str. Boryong, complete genome
ATGAAGAATAATATTGCACTTGAAACCTATTTAACTCCTTTTAAATTAATTTTTGATGAAGCAGGAGTAA
ATGAGGTGATGATTAACCGCCCTGGTGAGGTTTGGGTTGAAAAAAAGGGAAGCTATCGTCAAGAATTAAT
GAAAGATCTAGATTTTAGTCATTTAGCTGCTTTAGCTAGGTTAATAGCTCAGTCAACTGAACAAGTTATT
TCTGAAGAAAAACCATTACTTTCAGCTACTCTACCTAATGGCTATAGAGTGCAGGTAGTTTTTCCGCCAG
CTTGTGAAGTCGGATCAATAGGTATAGCTATTAGAAAAGTATCTTCTTTAAATATGACTTTAGAAGATTA
TAATAAAACAGGAGCATTTGATTACACGGCGATTGATGAAGTAATTGATGAAAATGATAAAATACTTAGT
GAATACCTTATTAATAAACAATTCAAAAATTTTTTGCAGCATGCAATAAAGTCCAAAAAAAATATTATTA
TTAGTGGTGGTACCTCTAGTGGTAAAACAACTTTTACTAATTCAGCTTTATTAGAAGTTCCGCACACAGA
AAGACTAATTACTGTTGAAGATGCTAGAGAAATTAGCATACCTAATCATCCAAATCGCTTACATTTATTA
GCTTCAAAAGGAAATCAAGGACGAGCAAAAGTTACTACTCAAGATTTAATTGAAGCTTGTTTAAGGCTAA
GGCCTGATAGAATAATAATTGGTGAGTTGCGAGGAGCGGAAGCATTTAGTTTTTTACGTGCTATTAATAC
AGGGCATCCAGGATCAATATCAACTTTACATGCAGATACTACTGCAATGGCTTTGGAGCAGTTAAAATTA
ATGGTAATGCAAGCTGGGCTAGGAATGCCGCCAGATGAAATCAAAAACTATATTAATGCAGTAATTGATA
TAGTAGTGCAATTGAAGCGTGGTGATCGTGGAATTAGATATATTTCTGAAATATATTTTAAAAAAATGAG
AAAAAAATAA
 Primer design