SecReT4
Protein ID: 148284004
T4SS name [ID]VirB [506]
Gene symbolvirD4
Locus tagOTBS_0007
StrainOrientia tsutsugamushi str. Boryong
Repliconchromosome [GenBank: NC_009488] [Browse all T4SS(s) in this replicon]
Location [Strand]6617..8389 [+]
Producttype IV secretion system component VirD4
Component typeVirD4
UniProt IDA5CBW9
KEGG IDots:OTBS_0007
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 8.8e-160, Aligned region: 122..568
TraG-D_C [PF12696], Evalue: 3.7e-28, Aligned region: 406..528
TrwB_AAD_bind [PF10412], Evalue: 4.8e-20, Aligned region: 238..536
Protein Sequence: 590 a.a.     [Download]
>gi|148284004|ref|YP_001248094.1| type IV secretion system component VirD4 [Orientia tsutsugamushi str. Boryong]
MNENAFLTKIRNLVIKIMVHCIGVILVVFIIKFFILLFTVKHQNLIDVLLTFNVSIVYQYLIWIINSWSL
IDFSSYDYLKLKLVFSFIVPPVITIVLYIKNFEKIKSWQPYKLKEKVYGDARWGDQDDIKRAGLRSKHGT
LLGVDKGGYYVADGFQHALLFAPTGSGKGVGFVIPNLLFWEHSVIVHDIKLENYELTSGWRAQQGQNVYV
WEPANPDGITHCYNPIDWVSSKPGQMVDDVQKIANLIMPEKDFWNNEARSLFLGVVLYLIADNTKAKTFG
EVVRTMRSNDVVYNLAVVLDTMGAVIHPVAYMNIAAFLQKADKERSGVISTMNSGLELWANPLIDAATAS
SDFNILEIKRKKTTIYVGLTPDNINRLQKLMQVFYQQSTEFLSRKIPDVKEEPYGVMFLLDEFPTLGKME
QFKTGIAYFRGYRVRLFLIIQDTQQLKGTYEEAGMNSFLSNSTYRITFAANNYETANLISQLCGNKTVKQ
ASHSQPRFFDLNPATRTMNISEVQRALLLPQEVILLPRDEQIILIESFPPIRSKKVKYYEDKFFTTRLLP
PSFVPTQTPYVPPDYNATADDSNNVDNNQK
 
Nucleotide Sequence: 1773 bp     [Download]
>gi|148283997|ref|NC_009488.1|:6617-8389 Orientia tsutsugamushi str. Boryong, complete genome
ATGAATGAGAATGCATTTTTAACTAAGATTAGAAATCTAGTTATAAAGATAATGGTTCATTGTATTGGAG
TAATATTAGTAGTTTTCATTATTAAATTTTTTATACTCTTATTTACTGTTAAACATCAAAATTTAATAGA
TGTATTACTAACTTTTAATGTATCCATTGTATATCAATATCTAATCTGGATTATAAATTCTTGGAGTTTA
ATTGATTTTAGTAGTTATGATTACTTAAAACTTAAATTAGTATTTTCATTTATAGTTCCACCTGTTATAA
CTATAGTGTTATATATCAAAAATTTCGAGAAAATTAAGAGTTGGCAACCATATAAATTGAAAGAAAAAGT
ATACGGTGATGCACGTTGGGGAGATCAAGATGATATAAAAAGAGCTGGTCTTAGATCAAAGCATGGTACA
TTGTTAGGTGTGGATAAGGGAGGATACTATGTTGCAGATGGATTTCAACATGCTTTATTATTTGCTCCTA
CTGGTTCAGGTAAAGGGGTAGGTTTTGTAATTCCAAATTTATTGTTTTGGGAACATTCGGTAATAGTTCA
CGATATTAAGCTTGAAAATTATGAATTAACTAGTGGCTGGCGAGCTCAGCAAGGACAAAATGTTTATGTA
TGGGAGCCAGCTAATCCAGATGGTATTACTCATTGTTATAATCCAATAGATTGGGTTAGTAGTAAACCTG
GGCAGATGGTTGATGATGTGCAGAAAATTGCTAACCTAATTATGCCAGAAAAAGACTTTTGGAATAATGA
GGCTAGAAGTCTGTTTTTAGGAGTTGTATTATATTTAATTGCTGACAATACAAAAGCTAAAACATTTGGT
GAAGTGGTCCGTACTATGCGCAGTAATGATGTAGTATATAATTTAGCAGTAGTATTGGATACTATGGGAG
CAGTTATTCATCCAGTTGCTTATATGAATATTGCTGCTTTTCTTCAAAAAGCTGATAAAGAACGCTCTGG
AGTAATATCAACTATGAATTCTGGGCTTGAATTATGGGCAAATCCATTAATTGATGCTGCAACTGCTTCA
TCAGATTTCAATATCTTAGAAATAAAAAGAAAAAAAACAACAATATATGTTGGCTTAACACCTGATAATA
TCAATAGATTGCAAAAATTAATGCAAGTATTTTATCAACAGTCTACTGAATTTTTAAGCAGAAAAATTCC
TGATGTTAAGGAAGAACCTTATGGGGTAATGTTTCTATTGGATGAGTTTCCAACTTTAGGTAAAATGGAA
CAATTTAAAACCGGAATTGCTTATTTTCGAGGTTATAGAGTAAGGTTATTTTTGATTATTCAAGATACGC
AACAGTTAAAAGGAACATATGAAGAAGCAGGAATGAATTCATTTTTATCTAATTCTACTTATAGAATTAC
CTTTGCTGCTAACAATTATGAGACTGCTAACTTGATATCACAGCTATGTGGTAATAAAACAGTAAAACAA
GCATCTCATAGTCAACCTCGCTTTTTTGATCTTAATCCAGCTACTAGAACTATGAATATTTCTGAAGTAC
AAAGAGCATTATTATTACCACAAGAAGTTATTTTACTGCCACGAGATGAGCAAATTATTTTAATTGAATC
GTTTCCACCAATACGATCTAAAAAGGTTAAATATTATGAGGACAAGTTTTTTACTACTAGATTACTACCA
CCTTCATTTGTTCCAACTCAAACACCTTATGTTCCTCCAGATTATAATGCTACAGCTGATGATAGTAATA
ACGTAGATAATAATCAAAAATAA
 Primer design