SecReT4
Protein ID: 148284181
T4SS name [ID]VirB [506]
Gene symbolvirB8
Locus tagOTBS_0339
StrainOrientia tsutsugamushi str. Boryong
Repliconchromosome [GenBank: NC_009488] [Browse all T4SS(s) in this replicon]
Location [Strand]333213..333914 [-]
Producttype IV secretion system protein
Component typeVirB8
UniProt IDA5CCH9
KEGG IDots:OTBS_0339
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 3.5e-19, Aligned region: 21..224
Protein Sequence: 233 a.a.     [Download]
>gi|148284181|ref|YP_001248271.1| type IV secretion system protein [Orientia tsutsugamushi str. Boryong]
MLMDNSEIAVDIKNSKYFQDAYRWYKAKYLYPFLHRSVVFIILALLLLLIVLSIINVYSLLPVTQSLKYI
ISVDEKFNAAAKITPADQVLKNPLQSIVKILAESYVVKRESYNYNQLASQFQYIKNRSTRGIFRQFVNYM
SLQNYQSPVLRYQKTAKRKIKILSSVFLNNDELAVYFHSCAIDDKGNMVEDMKWKANIIFETDQVNLNAA
SGSIFKFFVTDYKITLLQNNNEK
 
Nucleotide Sequence: 702 bp     [Download]
>gi|148283997|ref|NC_009488.1|:c333914-333213 Orientia tsutsugamushi str. Boryong, complete genome
ATGCTAATGGATAATAGTGAAATAGCAGTTGATATTAAAAATAGTAAATACTTTCAAGATGCTTATAGGT
GGTATAAAGCTAAGTATCTTTATCCATTTCTACATCGGTCTGTAGTATTTATTATACTAGCGTTATTATT
GCTATTAATAGTACTGAGTATAATTAATGTTTATAGCTTGCTGCCTGTTACACAATCACTAAAATATATT
ATTTCAGTAGATGAAAAATTTAATGCTGCTGCAAAAATAACTCCTGCAGATCAAGTACTTAAAAATCCAC
TTCAATCTATAGTAAAAATTTTAGCTGAAAGCTATGTTGTAAAACGTGAAAGTTATAACTACAATCAACT
TGCTAGTCAATTTCAATATATCAAGAATAGATCTACGCGAGGAATATTTAGACAATTTGTTAATTATATG
AGTCTTCAAAACTATCAGTCTCCTGTATTAAGATATCAAAAGACTGCTAAGCGTAAAATTAAGATTTTGT
CATCAGTATTTCTTAATAATGATGAGTTAGCTGTATATTTTCACTCATGTGCCATAGATGATAAAGGTAA
TATGGTTGAAGATATGAAGTGGAAAGCAAACATTATTTTTGAAACAGATCAAGTTAATTTAAATGCTGCA
TCTGGTTCAATTTTTAAATTTTTTGTAACAGATTATAAAATAACATTACTACAGAATAATAATGAGAAAT
AG
 Primer design