SecReT4
Protein ID: 148358309
T4SS name [ID]Trb [79]
Gene symboltrbC
Locus tagLPC_0171
StrainLegionella pneumophila str. Corby
Repliconchromosome [GenBank: NC_009494] [Browse all T4SS(s) in this replicon]
Location [Strand]186788..187165 [+]
Productconjugal transfer protein TrbC
Component typeTrbC
UniProt IDA5I9X0
KEGG IDlpc:LPC_0171
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 6.8e-18, Aligned region: 8..104
Protein Sequence: 125 a.a.     [Download]
>gi|148358309|ref|YP_001249516.1| conjugal transfer protein TrbC [Legionella pneumophila str. Corby]
MTQVSTLNYKKMWMMGLVVLFLLFITHPAMASTAGGGLPFDSWLTKIQKSITGPFAFSAAIIGLVAAGAT
LIFGGDMNGFMRTLVFFVLVLSFLVAAQNTMTAITGKGAEISKPSTEVNAAEHQL
 
Nucleotide Sequence: 378 bp     [Download]
>gi|295815281|ref|NC_009494.2|:186788-187165 Legionella pneumophila str. Corby chromosome, complete genome
ATGACTCAGGTAAGCACCTTAAATTATAAAAAAATGTGGATGATGGGATTAGTGGTTCTGTTTTTATTAT
TTATTACCCATCCAGCAATGGCCTCGACTGCTGGCGGTGGTCTTCCTTTTGATTCATGGCTCACCAAAAT
ACAAAAATCCATTACCGGCCCGTTTGCTTTTAGTGCAGCCATCATTGGATTAGTTGCTGCAGGCGCCACG
CTTATTTTTGGCGGCGATATGAATGGTTTTATGCGAACACTTGTCTTTTTTGTATTAGTGCTCTCATTTT
TGGTAGCCGCGCAAAATACCATGACGGCCATTACCGGCAAAGGTGCGGAAATATCTAAACCATCTACAGA
AGTGAATGCAGCGGAGCATCAGTTATGA
 Primer design