SecReT4
Protein ID: 148358313
T4SS name [ID]Trb [79]
Gene symboltrbG
Locus tagLPC_0175
StrainLegionella pneumophila str. Corby
Repliconchromosome [GenBank: NC_009494] [Browse all T4SS(s) in this replicon]
Location [Strand]190732..191607 [+]
Productconjugal transfer protein TrbG
Component typeTrbG
UniProt IDA5I9X4
KEGG IDlpc:LPC_0175
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 4.7e-57, Aligned region: 68..290
Protein Sequence: 291 a.a.     [Download]
>gi|148358313|ref|YP_001249520.1| conjugal transfer protein TrbG [Legionella pneumophila str. Corby]
MKKIILSIGLLLPFSIFAQDNDELSNRYFSQSMPKLTYQETQALKIAGKWQKGDKTSKPFQSSDGSVSFV
YGSGQISIVCAPLQVCDIALQPGELFNDMNVGDPRFIVEPSITGSGRNQQIHLIIKPKDVGLDSSLVVTT
DRRTYHFRLKSERFEFMPYISFIYPDEAKEKWRLIQKIQAENRKANTFPETNEYLGNLNFNYRIQGNARF
KPVRVYNDGVKTIIEMPKAMAQFEAPALLVLRKHGFLQKSKPVMVNYRLQGCRYIVDSVFDKAMLVVGSG
SAQEKITITRC
 
Nucleotide Sequence: 876 bp     [Download]
>gi|295815281|ref|NC_009494.2|:190732-191607 Legionella pneumophila str. Corby chromosome, complete genome
ATGAAAAAAATTATTCTCTCAATCGGTTTGTTGTTACCGTTTTCCATTTTTGCTCAAGATAATGATGAAC
TGAGCAACCGCTATTTTTCCCAAAGCATGCCTAAACTGACTTATCAGGAAACGCAAGCGTTAAAAATAGC
TGGAAAATGGCAAAAAGGTGATAAAACCAGTAAGCCGTTTCAATCTTCAGATGGCTCGGTCAGTTTTGTC
TATGGCTCTGGTCAAATCAGCATCGTTTGCGCGCCTTTGCAAGTTTGCGATATTGCTTTGCAACCAGGCG
AGCTATTTAACGACATGAATGTCGGTGATCCGCGCTTTATCGTTGAACCTTCCATTACAGGTTCAGGACG
AAACCAGCAAATTCATTTAATCATCAAACCCAAAGACGTTGGTCTGGATTCCTCGCTGGTCGTCACCACC
GATAGAAGAACCTATCATTTCCGTTTGAAATCAGAGCGCTTTGAGTTTATGCCGTATATTTCTTTTATCT
ATCCTGATGAGGCCAAAGAAAAATGGCGTTTAATTCAGAAAATTCAGGCAGAAAACAGAAAAGCCAATAC
CTTCCCAGAAACCAATGAGTACTTAGGCAACCTTAACTTTAATTATCGAATACAAGGAAATGCACGCTTC
AAACCGGTTCGGGTTTATAACGATGGCGTTAAAACCATCATTGAAATGCCCAAGGCTATGGCTCAATTTG
AAGCGCCTGCCCTTTTAGTCTTGAGAAAGCACGGTTTCTTGCAAAAATCAAAACCCGTGATGGTTAATTA
TCGCCTGCAAGGCTGTCGTTACATCGTGGATAGCGTTTTTGATAAGGCCATGCTCGTTGTTGGAAGCGGG
AGCGCTCAGGAAAAAATCACCATTACGAGGTGCTAA
 Primer design