SecReT4
Protein ID: 148358318
T4SS name [ID]Trb [79]
Gene symboltrbL
Locus tagLPC_0180
StrainLegionella pneumophila str. Corby
Repliconchromosome [GenBank: NC_009494] [Browse all T4SS(s) in this replicon]
Location [Strand]194211..195683 [+]
Productputative conjugal transfer protein TrbL
Component typeTrbL
UniProt IDA5I9X9
KEGG IDlpc:LPC_0180
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 1.4e-34, Aligned region: 83..297
Protein Sequence: 490 a.a.     [Download]
>gi|148358318|ref|YP_001249525.1| putative conjugal transfer protein TrbL [Legionella pneumophila str. Corby]
MPVLNEAVIQKAQAINGNLMKKKTITYLAVFLLIGFSVNCHAHNSSIDSRDLLDNILYRFSATASMWSQT
ILSYARYLFWSLATISMVWTYGLMALRKADIQEFMAETVRFLVVVGFFYWLLDNGPAIATAIMDSMRKLA
ANAAGIDAHISPSDIVDVGFDIVSKAIDNSSIWSPAATTVGLIVAGVILVVLALVSINMLIILITAWILT
YAGVILLGFGGGRWTQDIAIQYYKTMLGTALQAFSMILIIGIGKSFVDQYYAAMSNDILLKEMFIMLVVA
ILLLVLINKIPPVLSGIVSGGGPSGGGNGIGLGGALGAAGIAGTALAGAAGAASAHSAGGLSALHAAFKA
ASQSVGAGDSGSFSGGNSGSKLGGLAQAMGQASKFAGSFSSHLASGAFDVASEKLGSMKDSFSAKTAETT
GGKIADAIQQRASSNAHSVTSNKTPATDNVTSMGAPEGSFSSGSGEYNQESGGADEVSQFVNQKASGESL
 
Nucleotide Sequence: 1473 bp     [Download]
>gi|295815281|ref|NC_009494.2|:194211-195683 Legionella pneumophila str. Corby chromosome, complete genome
ATGCCTGTTTTAAACGAGGCAGTTATTCAAAAAGCTCAGGCCATAAATGGTAATCTTATGAAAAAAAAGA
CAATTACTTATTTAGCTGTATTCTTGTTAATCGGTTTTTCAGTAAATTGTCATGCACATAATAGCAGCAT
AGACAGCCGAGATTTGCTGGATAATATTTTGTACCGTTTTTCTGCTACCGCTTCGATGTGGAGTCAAACA
ATCCTAAGCTATGCTCGTTATCTTTTTTGGTCTTTAGCCACAATCAGCATGGTATGGACTTATGGCTTAA
TGGCGCTTCGTAAAGCCGATATACAAGAATTTATGGCGGAAACCGTGCGGTTTTTAGTGGTTGTCGGTTT
TTTCTACTGGCTTTTAGACAATGGACCTGCCATTGCTACGGCCATCATGGACTCCATGCGGAAGCTCGCG
GCCAATGCCGCTGGAATTGATGCACATATATCTCCATCCGATATCGTCGATGTGGGCTTTGATATTGTTT
CAAAAGCGATTGATAACTCATCCATCTGGTCTCCTGCTGCAACAACGGTTGGCTTGATTGTCGCAGGCGT
TATCTTAGTTGTTCTGGCGTTGGTCAGCATCAATATGCTCATCATCTTAATCACCGCCTGGATATTAACC
TATGCCGGCGTCATTTTATTAGGCTTTGGTGGTGGTCGCTGGACTCAAGATATCGCCATTCAATATTACA
AAACGATGCTTGGGACGGCTCTTCAGGCATTTTCGATGATTTTGATTATCGGCATCGGCAAGTCCTTTGT
GGATCAATACTATGCAGCCATGTCAAATGACATTCTTCTTAAGGAAATGTTCATTATGCTGGTTGTCGCA
ATTCTTTTGCTGGTTCTTATCAATAAAATCCCACCTGTTTTATCTGGCATTGTATCGGGCGGGGGTCCAA
GCGGCGGTGGCAATGGGATTGGGTTAGGCGGCGCTTTAGGTGCAGCAGGTATTGCAGGGACTGCATTAGC
AGGCGCTGCGGGTGCCGCGAGCGCTCACAGTGCAGGCGGTCTTTCAGCATTGCATGCCGCGTTCAAAGCA
GCTTCTCAAAGTGTTGGAGCGGGTGATAGCGGCTCTTTTTCTGGTGGCAATTCGGGTTCAAAGCTTGGAG
GGTTGGCTCAAGCCATGGGACAGGCTTCCAAGTTTGCCGGTTCATTTAGTTCGCATCTGGCTTCTGGGGC
GTTTGATGTCGCAAGCGAAAAACTAGGTAGTATGAAAGACTCATTTTCTGCAAAAACCGCTGAAACGACA
GGAGGAAAAATTGCAGATGCCATTCAACAACGCGCCTCATCCAATGCTCATTCAGTAACCAGCAATAAGA
CCCCCGCTACTGATAACGTGACCTCAATGGGGGCACCTGAAGGCAGTTTCAGTTCGGGAAGTGGCGAATA
TAATCAAGAATCAGGCGGTGCAGATGAAGTCAGTCAGTTTGTCAATCAAAAAGCATCTGGAGAAAGCCTG
TGA
 Primer design