SecReT4
Protein ID: 148359936
T4SS name [ID]Tfc [765]
Gene symbol-
Locus tagLPC_1865
StrainLegionella pneumophila str. Corby
Repliconchromosome [GenBank: NC_009494] [Browse all T4SS(s) in this replicon]
Location [Strand]2812085..2812783 [+]
Producthypothetical protein
Component typeTfc8
UniProt IDA5IEJ7
KEGG IDlpc:LPC_1865
PDB IDNA
Domain hit(s) vs Pfam DUF4400 [PF14348], Evalue: 7e-52, Aligned region: 39..229
Protein Sequence: 232 a.a.     [Download]
>gi|148359936|ref|YP_001251143.1| hypothetical protein LPC_1865 [Legionella pneumophila str. Corby]
MAIRTATPKPSKKTVMSFMLLVLLGWLILMGWVSSLWCCLGFEKAFSSVTTLSQKQTQAITAFNGVIVAN
TIKSWLKTIPTQGVANKAAQTGSLIKKGLDEVMPDETNDLNEIAQDFILIANQVWLLMGLTTQVMFIKLV
ILISAIPLFLLMVVVGLVDGLNQRAIRTASLGRESSYVFHQLNRHAKRGLLLLLSLWLALPISITPAFVF
VPASLLLGIMVSITASRFKKYL
 
Nucleotide Sequence: 699 bp     [Download]
>gi|295815281|ref|NC_009494.2|:2812085-2812783 Legionella pneumophila str. Corby chromosome, complete genome
ATGGCAATAAGGACTGCAACGCCCAAACCCTCCAAAAAAACGGTCATGAGTTTTATGCTGCTTGTTTTAT
TGGGCTGGTTAATCCTTATGGGTTGGGTATCCAGTCTTTGGTGCTGTTTAGGATTTGAAAAAGCGTTTAG
TTCAGTCACCACACTTTCCCAAAAACAAACGCAAGCAATTACCGCATTTAACGGAGTGATAGTTGCTAAC
ACTATTAAATCCTGGTTAAAAACCATTCCTACTCAAGGTGTTGCCAACAAAGCGGCGCAAACAGGCTCCC
TGATTAAAAAAGGGCTGGATGAGGTGATGCCTGATGAAACCAACGATTTAAATGAAATAGCACAAGATTT
TATCCTAATTGCCAATCAAGTTTGGTTACTGATGGGATTAACTACTCAAGTAATGTTCATCAAACTGGTT
ATTCTGATTTCGGCTATCCCTCTGTTTTTATTAATGGTCGTGGTTGGACTGGTTGATGGGTTAAATCAAC
GCGCTATCCGCACCGCATCATTAGGCCGTGAATCATCCTATGTCTTTCACCAACTCAATCGCCACGCCAA
GCGAGGCCTTTTACTGTTATTAAGCTTATGGCTTGCGCTGCCCATAAGCATCACGCCTGCCTTTGTTTTT
GTACCTGCAAGCCTATTGCTAGGCATCATGGTTTCAATCACCGCCAGTCGATTTAAAAAATATTTGTAG
 Primer design