SecReT4
Protein ID: 148359937
T4SS name [ID]Tfc [765]
Gene symbol-
Locus tagLPC_1866
StrainLegionella pneumophila str. Corby
Repliconchromosome [GenBank: NC_009494] [Browse all T4SS(s) in this replicon]
Location [Strand]2812793..2813116 [+]
Producthypothetical protein
Component typeTfc9
UniProt IDA5IEJ8
KEGG IDlpc:LPC_1866
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 107 a.a.     [Download]
>gi|148359937|ref|YP_001251144.1| hypothetical protein LPC_1866 [Legionella pneumophila str. Corby]
MKRLLLLLILSLPMASHASDDALNQTLVRIINQINAIMPLLDEAKTEIEPNTRIQLHIDHFEGSDGKIHA
GLRTDLLSIRNALIDYINKPVIEPKTIKPLALDFIGK
 
Nucleotide Sequence: 324 bp     [Download]
>gi|295815281|ref|NC_009494.2|:2812793-2813116 Legionella pneumophila str. Corby chromosome, complete genome
ATGAAACGATTATTGTTATTACTCATATTAAGTCTGCCAATGGCCTCTCATGCGAGTGACGATGCACTCA
ACCAAACGCTAGTCAGAATAATTAATCAGATTAATGCCATCATGCCTTTGCTTGATGAAGCGAAAACGGA
AATTGAACCCAATACCCGCATCCAATTGCATATAGATCATTTTGAAGGCTCTGATGGAAAGATACACGCA
GGCCTTCGTACCGATTTACTGTCCATTCGTAATGCGCTGATTGATTACATCAATAAACCAGTCATTGAAC
CTAAAACCATCAAGCCGTTAGCGTTGGATTTTATAGGAAAGTGA
 Primer design