SecReT4
Protein ID: 148359940
T4SS name [ID]Tfc [765]
Gene symbol-
Locus tagLPC_1869
StrainLegionella pneumophila str. Corby
Repliconchromosome [GenBank: NC_009494] [Browse all T4SS(s) in this replicon]
Location [Strand]2813780..2814130 [+]
Producthypothetical protein
Component typeTfc11
UniProt IDA5IEK1
KEGG IDlpc:LPC_1869
PDB IDNA
Domain hit(s) vs Pfam DUF3487 [PF11990], Evalue: 1.4e-09, Aligned region: 16..113
Protein Sequence: 116 a.a.     [Download]
>gi|148359940|ref|YP_001251147.1| hypothetical protein LPC_1869 [Legionella pneumophila str. Corby]
MNQPSSRHLSFDYEAYKGLSLRELFWIVVVTTPLISMGCALAGLFIGYPLAFGCIGFIVGFIVSITFCPK
RAAAIKAGKPHGYLMKKTVLLMAKWGLRHSPYIHHQGVWQKSRLVR
 
Nucleotide Sequence: 351 bp     [Download]
>gi|295815281|ref|NC_009494.2|:2813780-2814130 Legionella pneumophila str. Corby chromosome, complete genome
ATGAATCAACCCTCCTCACGTCATCTGTCGTTTGATTATGAAGCCTATAAAGGGTTAAGCCTAAGGGAGC
TTTTCTGGATAGTGGTGGTCACAACACCACTAATTAGCATGGGATGTGCTTTGGCAGGACTTTTTATTGG
CTATCCGTTGGCCTTCGGATGTATTGGTTTCATTGTTGGTTTTATTGTGTCCATTACTTTTTGCCCTAAA
CGAGCAGCTGCCATTAAAGCGGGTAAACCGCATGGCTATTTAATGAAAAAAACCGTGTTGTTGATGGCAA
AGTGGGGGTTAAGACACTCGCCCTACATTCACCATCAAGGTGTCTGGCAAAAATCAAGACTCGTGAGGTA
G
 Primer design