SecReT4
Protein ID: 148359947
T4SS name [ID]Tfc [765]
Gene symbol-
Locus tagLPC_1876
StrainLegionella pneumophila str. Corby
Repliconchromosome [GenBank: NC_009494] [Browse all T4SS(s) in this replicon]
Location [Strand]2820987..2822369 [+]
Productpilus retraction ATPase PilT
Component typeTfc22
UniProt IDA5IEK8
KEGG IDlpc:LPC_1876
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 460 a.a.     [Download]
>gi|148359947|ref|YP_001251154.1| pilus retraction ATPase PilT [Legionella pneumophila str. Corby]
MHKLSMSLLALMLPKMLFASSFMPNESDYYYKLGGSSNLYVPPVNNDQTITIGGNVDGRLGFTCNGFNPV
VSITNTFQDMKSSAMNIPGGIIDNLKGSVAGFPLYKLQQSMPALYNVLQNTASYAQNEFSVKVKDCQDVK
KTLEEGQSPMESMLSVSDSQGWLEAAKRAKTENVDVTSTAKSIAKKRDEYGLPWIGRESGNAGGTYQRPI
KVINDVVIAGYNILLNRKPLNNEKKPDTKTPMTHTWPTPADASKWAVKVLGDIHVSTATDADKTKHDAKA
GIGLSALLQSCDSSNTCTSNVSKALWNLVDKQWPLTEEKLKMVSASNLMITDEIIITIQRMPREEQILTV
SKLAEEIAVQNMLDKALMMRRILQAGLQVQEVQNLKPALDMVKFALKKLDDDIHSLSFESEVRKKMMTET
LGLLMDMRGSDIAKGLPGEDHEQSQVKNGAVYAKPDSKGA
 
Nucleotide Sequence: 1383 bp     [Download]
>gi|295815281|ref|NC_009494.2|:2820987-2822369 Legionella pneumophila str. Corby chromosome, complete genome
ATGCACAAACTGTCTATGTCTTTACTGGCATTGATGCTACCAAAAATGCTCTTTGCCAGTTCTTTTATGC
CTAATGAATCGGATTATTATTACAAGTTGGGTGGCTCATCCAATCTATATGTACCCCCTGTTAATAATGA
CCAAACCATCACTATTGGTGGTAATGTCGATGGGCGGCTTGGCTTTACCTGTAATGGGTTTAATCCTGTA
GTCTCCATTACTAATACATTTCAGGATATGAAGTCTTCTGCCATGAATATTCCTGGCGGTATTATTGATA
ACCTCAAAGGATCTGTTGCAGGATTTCCGCTGTATAAGCTACAACAATCCATGCCTGCGCTTTATAACGT
ACTGCAAAATACGGCCAGTTACGCACAGAATGAATTTAGCGTCAAAGTTAAAGATTGCCAGGACGTGAAA
AAGACCTTGGAAGAAGGACAATCGCCTATGGAAAGCATGCTTTCTGTGTCGGATAGTCAAGGCTGGCTTG
AAGCGGCAAAACGGGCGAAAACTGAAAATGTGGATGTGACTTCAACAGCTAAAAGTATTGCCAAAAAACG
TGACGAATATGGACTGCCCTGGATAGGACGAGAAAGCGGGAATGCCGGTGGAACATACCAACGGCCTATC
AAAGTCATTAACGATGTAGTCATTGCGGGTTACAATATTTTACTGAATCGCAAACCACTTAATAATGAAA
AGAAGCCCGATACTAAAACACCCATGACGCATACTTGGCCAACACCTGCTGATGCCAGTAAATGGGCAGT
TAAAGTATTAGGTGATATTCATGTAAGCACCGCTACAGATGCAGATAAAACCAAACACGATGCCAAAGCT
GGCATTGGATTATCCGCGTTATTGCAAAGTTGTGACAGCTCCAACACCTGTACTTCCAATGTGTCTAAAG
CACTGTGGAATCTAGTAGACAAGCAATGGCCGTTGACTGAAGAAAAACTCAAAATGGTTAGTGCATCCAA
CTTGATGATTACAGATGAAATCATCATCACCATACAACGTATGCCGCGGGAAGAACAAATCTTAACTGTT
TCCAAATTGGCCGAGGAAATTGCTGTACAAAACATGCTCGATAAGGCCTTGATGATGCGCCGTATTTTAC
AAGCTGGTCTTCAAGTACAAGAAGTACAAAACTTAAAGCCCGCGCTTGATATGGTGAAATTTGCCTTAAA
GAAACTCGATGATGACATTCATTCTTTATCTTTTGAAAGCGAAGTCCGTAAAAAAATGATGACTGAAACC
TTAGGTCTTTTGATGGATATGCGAGGTAGCGATATAGCCAAGGGCTTGCCTGGTGAAGATCATGAACAAT
CGCAAGTTAAAAATGGCGCAGTCTATGCGAAACCTGATTCCAAAGGAGCATAA
 Primer design