SecReT4
Protein ID: 148360343
T4SS name [ID]Tfc [764]
Gene symbol-
Locus tagLPC_2281
StrainLegionella pneumophila str. Corby
Repliconchromosome [GenBank: NC_009494] [Browse all T4SS(s) in this replicon]
Location [Strand]1202881..1203513 [-]
Producthypothetical protein
Component typeTfc8
UniProt IDA5IFQ4
KEGG IDlpc:LPC_2281
PDB IDNA
Domain hit(s) vs Pfam DUF4400 [PF14348], Evalue: 1.1e-42, Aligned region: 43..207
Protein Sequence: 210 a.a.     [Download]
>gi|148360343|ref|YP_001251550.1| hypothetical protein LPC_2281 [Legionella pneumophila str. Corby]
MAVKQYSRQLTMQLTIVLFLGWLAIIIWVLSQWMLHGYALAFEQVNILVNTQREAITPVYQGSLLAVLPL
NAKPDWALVIPYLNKLAINDLVKDLIEKSQQFLQILLLSSQCLLIKLIILFAALPLFALTMIAGLVDGLN
QRAIRTACLGRESSYVFHRLNHFLKKGLVILLMLWLALPVSITPAYVFVPVSLLMGLMVAMTASRFKKYL
 
Nucleotide Sequence: 633 bp     [Download]
>gi|295815281|ref|NC_009494.2|:c1203513-1202881 Legionella pneumophila str. Corby chromosome, complete genome
ATGGCAGTAAAACAATATTCAAGACAACTGACCATGCAATTAACCATAGTGCTATTCTTAGGTTGGTTAG
CAATTATTATCTGGGTATTGAGCCAATGGATGCTGCATGGCTACGCCCTCGCTTTTGAACAAGTGAATAT
CCTTGTAAACACTCAAAGAGAGGCCATTACTCCTGTTTATCAAGGCTCCCTTCTGGCAGTCCTTCCTTTA
AATGCCAAACCGGATTGGGCATTAGTCATTCCCTATTTAAACAAATTGGCCATCAATGATCTTGTCAAGG
ACTTAATCGAAAAATCACAACAATTCTTGCAGATCCTTTTATTAAGCAGCCAATGCCTTTTAATCAAACT
CATTATCCTATTCGCTGCCTTGCCCTTATTTGCTTTAACCATGATTGCAGGTCTGGTTGACGGTCTAAAT
CAAAGAGCGATACGCACTGCTTGTTTAGGTCGTGAATCCTCTTACGTGTTCCACAGGCTGAATCACTTTT
TAAAAAAGGGACTTGTGATTTTACTCATGCTGTGGCTTGCCCTACCCGTCAGCATCACCCCTGCTTATGT
CTTTGTACCTGTCAGTTTATTGATGGGATTAATGGTTGCCATGACGGCCAGCCGCTTTAAGAAATACTTA
TAG
 Primer design