SecReT4
Protein ID: 148360344
T4SS name [ID]Tfc [764]
Gene symbol-
Locus tagLPC_2282
StrainLegionella pneumophila str. Corby
Repliconchromosome [GenBank: NC_009494] [Browse all T4SS(s) in this replicon]
Location [Strand]1202545..1202871 [-]
Producthypothetical protein
Component typeTfc9
UniProt IDA5IFQ5
KEGG IDlpc:LPC_2282
PDB IDNA
Domain hit(s) vs Pfam Plasmid_RAQPRD [PF09686], Evalue: 4.1e-05, Aligned region: 24..103
Protein Sequence: 108 a.a.     [Download]
>gi|148360344|ref|YP_001251551.1| hypothetical protein LPC_2282 [Legionella pneumophila str. Corby]
MKRILCLILMIISLQCSANNPDLNETLVRIINQINAIMPLLDEAQTQITPNARIQLQIEGFEDLQGQHHA
GLREDLLNIRNGLIDYINQPIIAPRKIKPLEMDFVRKP
 
Nucleotide Sequence: 327 bp     [Download]
>gi|295815281|ref|NC_009494.2|:c1202871-1202545 Legionella pneumophila str. Corby chromosome, complete genome
ATGAAACGAATATTATGCCTGATCTTAATGATAATAAGCCTGCAATGCTCAGCGAATAACCCTGATTTAA
ATGAAACGCTGGTACGGATTATTAATCAGATTAACGCCATCATGCCTTTGCTTGATGAAGCGCAAACACA
AATAACACCTAACGCTCGTATCCAATTGCAAATAGAGGGATTTGAAGATCTGCAAGGACAACATCACGCA
GGATTGAGAGAGGATTTGCTAAACATCCGCAACGGTCTGATTGACTATATCAACCAGCCCATCATTGCCC
CTCGAAAAATTAAACCATTAGAAATGGATTTTGTGAGGAAACCCTAA
 Primer design