SecReT4
Protein ID: 148360347
T4SS name [ID]Tfc [764]
Gene symbol-
Locus tagLPC_2285
StrainLegionella pneumophila str. Corby
Repliconchromosome [GenBank: NC_009494] [Browse all T4SS(s) in this replicon]
Location [Strand]1201543..1201905 [-]
Producthypothetical protein
Component typeTfc11
UniProt IDA5IFQ8
KEGG IDlpc:LPC_2285
PDB IDNA
Domain hit(s) vs Pfam DUF3487 [PF11990], Evalue: 9.2e-10, Aligned region: 11..113
Protein Sequence: 120 a.a.     [Download]
>gi|148360347|ref|YP_001251554.1| hypothetical protein LPC_2285 [Legionella pneumophila str. Corby]
MSQPSSRHLSHDFPAWKGLSLRELFWIVVTTTPVTTLLFILLGTMAGYPLAAGCIGFVIGFILSITVWPK
GVARIKAGKPYGYVMKKTIQWMVRLRLKHSPWIHYQGQWQKNKSVGEPHV
 
Nucleotide Sequence: 363 bp     [Download]
>gi|295815281|ref|NC_009494.2|:c1201905-1201543 Legionella pneumophila str. Corby chromosome, complete genome
ATGAGCCAGCCTTCTTCGCGCCATCTATCACATGACTTCCCAGCCTGGAAAGGCTTAAGTCTGCGTGAAT
TGTTTTGGATTGTCGTCACTACAACACCAGTAACTACCTTGCTTTTTATTCTTTTAGGAACAATGGCAGG
GTATCCTCTAGCCGCTGGCTGCATCGGTTTTGTGATTGGATTCATCCTCTCCATTACCGTGTGGCCAAAA
GGTGTCGCCCGTATCAAAGCTGGCAAACCTTACGGTTATGTGATGAAGAAAACCATTCAATGGATGGTGC
GATTAAGGCTCAAACACTCGCCCTGGATTCATTACCAGGGACAGTGGCAAAAGAATAAATCTGTTGGAGA
GCCTCATGTTTGA
 Primer design