SecReT4
Protein ID: 148360354
T4SS name [ID]Tfc [764]
Gene symbol-
Locus tagLPC_2292
StrainLegionella pneumophila str. Corby
Repliconchromosome [GenBank: NC_009494] [Browse all T4SS(s) in this replicon]
Location [Strand]1193467..1194834 [-]
Productpilus retraction ATPase PilT
Component typeTfc22
UniProt IDA5IFR5
KEGG IDlpc:LPC_2292
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 455 a.a.     [Download]
>gi|148360354|ref|YP_001251561.1| pilus retraction ATPase PilT [Legionella pneumophila str. Corby]
MNKYLLLTLLIPHLTHAGNFMPSQSDYYYELGGTSNLFIPPVNKDQTLVIGADIDGRMGFSCSGFNPVVS
ITNTFQDLKKSALNIPGGVIDNLKGSVAGFPLYKLQQSMPALYNVLQNAASSAQNEFTLKVKDCQEVKQA
LEQNQSPMEGILSVSDSQGWLDAAKRAKKENVDVTETSKSIAQKRDEYGLPWIGSNKGNAGGKFQRPIKV
INDVVIAGYNILLERKPLDSLEKPSTKIPMVQSWPTPTDAANWAVKVLGDIQVSSSENKQSHDAKAGIGL
SALLQSCANANTCSQNIAKALWNLVNGTWTLTEENLSKVSASNLLITDEVITTIQHLPREEQMLTVSKLA
EEIAVQNMLDKALMMRRILQAGLQVQEVQNLKPAMNMVLFALKKLDDDIHSLSFENDVRKKMMTETLGTI
MDIRHQAQSQNMPGQDHEQPAVKNGAIYVKENKGA
 
Nucleotide Sequence: 1368 bp     [Download]
>gi|295815281|ref|NC_009494.2|:c1194834-1193467 Legionella pneumophila str. Corby chromosome, complete genome
ATGAATAAATATCTATTATTAACCTTACTTATTCCGCACCTAACCCATGCCGGAAACTTTATGCCCAGCC
AATCAGATTACTATTATGAATTAGGAGGAACCTCCAATTTATTTATACCACCTGTTAATAAAGATCAAAC
GCTGGTTATTGGTGCAGATATTGATGGCCGTATGGGATTCTCTTGTAGCGGTTTTAATCCTGTCGTATCC
ATTACCAATACCTTTCAGGATTTAAAAAAATCAGCATTAAATATCCCTGGTGGTGTCATTGATAACTTAA
AAGGTTCAGTCGCAGGATTCCCTCTTTATAAGCTGCAACAGTCCATGCCTGCTTTATACAATGTTCTACA
AAACGCTGCATCCAGTGCACAAAACGAATTTACCCTCAAGGTTAAAGATTGTCAGGAAGTCAAACAAGCA
CTGGAACAAAACCAATCTCCAATGGAAGGCATATTATCAGTATCCGATAGTCAAGGATGGCTTGATGCTG
CCAAACGAGCTAAAAAGGAAAACGTCGATGTGACCGAAACATCAAAAAGCATCGCTCAAAAGCGAGATGA
ATATGGTCTACCCTGGATAGGCAGCAATAAAGGCAATGCGGGCGGTAAGTTTCAACGCCCAATTAAGGTA
ATTAATGATGTAGTCATTGCGGGCTACAACATTCTTTTAGAGAGAAAACCTTTAGATTCTTTGGAAAAAC
CAAGCACCAAAATTCCTATGGTACAAAGCTGGCCAACACCTACCGATGCTGCTAATTGGGCAGTTAAGGT
TCTTGGCGATATCCAGGTCAGCAGCAGTGAAAACAAACAAAGCCATGATGCTAAAGCAGGGATTGGTTTA
TCAGCTTTATTGCAAAGCTGCGCGAACGCCAATACCTGTAGCCAGAACATTGCCAAGGCCTTATGGAATT
TAGTCAATGGTACTTGGACGCTTACTGAAGAAAATCTGAGTAAAGTCAGTGCCTCCAATTTACTGATTAC
TGATGAAGTCATTACTACTATTCAGCACCTGCCCCGTGAAGAACAAATGCTTACTGTCTCAAAACTGGCA
GAAGAAATCGCTGTTCAAAATATGCTGGATAAAGCCTTAATGATGCGCCGCATCTTACAAGCAGGATTAC
AAGTGCAAGAAGTACAGAATTTAAAACCTGCTATGAATATGGTCTTGTTTGCCCTGAAAAAACTAGACGA
TGACATTCATTCTTTGTCCTTTGAAAACGATGTCCGCAAAAAAATGATGACTGAGACTTTGGGAACCATC
ATGGACATTCGCCATCAAGCCCAAAGCCAAAATATGCCAGGCCAGGATCACGAACAGCCTGCTGTTAAAA
ACGGCGCAATCTACGTTAAAGAAAATAAAGGAGCTTAA
 Primer design