SecReT4
Protein ID: 148360842
T4SS name [ID]Trb [80]
Gene symboltrbL
Locus tagLPC_2802
StrainLegionella pneumophila str. Corby
Repliconchromosome [GenBank: NC_009494] [Browse all T4SS(s) in this replicon]
Location [Strand]627799..629196 [+]
Productconjugal transfer protein TrbL
Component typeTrbL
UniProt IDA5IH53
KEGG IDlpc:LPC_2802
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 1.1e-33, Aligned region: 64..278
Protein Sequence: 465 a.a.     [Download]
>gi|148360842|ref|YP_001252049.1| conjugal transfer protein TrbL [Legionella pneumophila str. Corby]
MNKKTTTSLLILCLLGFSVCCHAQGHGIDSRDLLDNILYRFSSTASMWSQTILSYARYLFWSLATISMVW
TYGLMALRKADIQEFLAETVKFLVVVGFFYWILDNGPAIATAIMDSMRLLAAKASGINEHVSPSDIVDVG
FDIVSKAIDSSSIWSPAATTVGLIVAGLILIILALVSINMLIILITAWILTYGGIILLGFGGGRWTQDIA
INYYKTVLGIALQAFAMILIIGIGKSFVDQYYAAMSENIMLKEMFVMMVVAVLLLVLINKIPPVLSGIVS
GGGSGGGGGLGLGGALGAAGIAGTALAGAAGAAAVQSAGGLSALQAAFKAASHSIGASGAGSVSGDSPGS
KQGSLAQAMGQASKFAGSFGSHLASGAFDVAREKAASMKDAFSAKAADTTGGKIADAIHQRISSNAESPT
INQQVSESQNVTSMGAPEGSFSSCNINSDDEISQFVNQKASGDGQ
 
Nucleotide Sequence: 1398 bp     [Download]
>gi|295815281|ref|NC_009494.2|:627799-629196 Legionella pneumophila str. Corby chromosome, complete genome
ATGAATAAAAAGACAACCACCTCTTTACTCATACTCTGTTTGCTAGGCTTTTCTGTATGCTGTCATGCCC
AGGGCCATGGTATAGACAGCAGAGATTTGCTAGACAATATCTTATATCGTTTTTCCAGCACTGCCTCGAT
GTGGAGCCAAACTATTTTAAGTTATGCTCGTTACCTTTTTTGGTCTTTGGCCACCATCAGCATGGTATGG
ACTTATGGTCTCATGGCTTTGCGAAAAGCAGACATTCAAGAGTTTTTGGCAGAAACCGTAAAATTTTTAG
TGGTTGTCGGTTTTTTCTATTGGATTTTAGATAATGGGCCTGCGATTGCAACTGCAATCATGGATTCTAT
GCGACTGCTCGCTGCAAAAGCTTCTGGAATTAACGAACATGTGTCGCCTTCTGACATTGTGGATGTGGGG
TTTGATATTGTATCAAAAGCAATCGACAGCTCATCAATCTGGTCACCGGCTGCAACGACGGTAGGATTAA
TTGTTGCTGGGCTTATTCTGATTATATTGGCGTTGGTCAGTATTAATATGCTCATTATCCTGATTACAGC
CTGGATCTTGACTTATGGTGGCATCATTTTATTAGGTTTTGGCGGCGGACGCTGGACACAGGATATTGCG
ATTAACTATTACAAAACAGTACTAGGGATCGCATTACAAGCCTTTGCCATGATTTTGATTATCGGCATAG
GAAAGTCTTTTGTAGATCAATATTATGCGGCAATGTCAGAAAACATCATGCTAAAAGAAATGTTTGTCAT
GATGGTTGTTGCCGTACTTTTGTTGGTACTTATCAATAAAATTCCCCCTGTTTTATCCGGCATCGTTTCA
GGTGGAGGATCAGGTGGCGGTGGTGGACTTGGTCTTGGAGGCGCGTTAGGGGCTGCGGGAATTGCAGGAA
CAGCCTTAGCAGGCGCTGCGGGTGCTGCAGCTGTGCAGAGTGCTGGGGGATTATCCGCTTTACAGGCTGC
ATTCAAGGCTGCTTCTCATAGTATCGGCGCAAGTGGCGCTGGCTCCGTGTCAGGAGATAGCCCAGGCTCA
AAACAAGGTAGTTTGGCTCAGGCCATGGGACAAGCTTCTAAATTTGCTGGTTCCTTTGGTTCACATTTAG
CTTCTGGGGCGTTTGATGTCGCCCGTGAAAAAGCAGCAAGCATGAAAGATGCTTTTTCTGCAAAAGCGGC
TGATACCACAGGCGGTAAAATTGCTGATGCCATTCATCAGCGCATATCTTCCAATGCTGAATCGCCAACT
ATTAATCAACAGGTATCCGAGTCTCAAAATGTCACTTCTATGGGTGCTCCAGAAGGCAGTTTTAGTTCAT
GTAACATAAACAGTGATGATGAGATCAGTCAATTTGTCAATCAAAAAGCATCTGGAGACGGTCAATGA
 Primer design