SecReT4
Protein ID: 148360847
T4SS name [ID]Trb [80]
Gene symboltrbG
Locus tagLPC_2807
StrainLegionella pneumophila str. Corby
Repliconchromosome [GenBank: NC_009494] [Browse all T4SS(s) in this replicon]
Location [Strand]624255..625130 [+]
Productconjugal transfer protein TrbG
Component typeTrbG
UniProt IDA5IH58
KEGG IDlpc:LPC_2807
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 2.6e-56, Aligned region: 68..290
Protein Sequence: 291 a.a.     [Download]
>gi|148360847|ref|YP_001252054.1| conjugal transfer protein TrbG [Legionella pneumophila str. Corby]
MKKIMLTFCLLMPLTGFALDNNELATRYFSENDPKLSNQEKQALDIAERWQKGDKTSKPFPSSDGSVSFV
YGSGQIRVVCAPLQVCDIALQAGEQFNDMNVGDPRFIVEPSITGSGAAQQIHLLIKPKDVGLDSSLVVTT
DRRTYHFRLKSDRTEFMPYVSFIYPDEAKAKWQFIQNVQAERRKMDTLPETNEYLGNLNFNYRIQGHARF
KPLRVYNNGVKTIIEMPKTMAQSEAPVLLVLRSRGLFQKSESVMVNYRLQGCRYIVDSVFDRAILVIGSG
SSQEKITITRC
 
Nucleotide Sequence: 876 bp     [Download]
>gi|295815281|ref|NC_009494.2|:624255-625130 Legionella pneumophila str. Corby chromosome, complete genome
ATGAAAAAAATAATGCTCACTTTTTGTTTATTGATGCCATTGACAGGTTTTGCCCTGGATAATAATGAGC
TGGCCACTCGTTATTTTTCCGAAAACGATCCAAAACTGTCAAATCAGGAAAAGCAGGCTTTAGATATTGC
AGAGCGTTGGCAAAAGGGAGACAAAACCAGCAAACCATTTCCATCCTCGGATGGATCAGTCAGTTTTGTT
TATGGCTCAGGGCAAATCAGGGTAGTATGCGCTCCCTTGCAGGTTTGTGATATTGCTTTGCAGGCAGGTG
AGCAGTTTAACGATATGAATGTTGGTGATCCACGCTTCATTGTTGAGCCATCCATTACGGGTTCAGGAGC
TGCGCAACAAATCCACTTATTGATCAAGCCTAAAGATGTTGGACTTGATTCCTCTTTGGTCGTAACTACA
GACAGAAGAACTTATCATTTCAGGTTAAAGTCCGACCGCACTGAGTTTATGCCTTACGTATCTTTCATTT
ATCCCGATGAAGCAAAAGCAAAGTGGCAGTTCATTCAAAATGTTCAGGCCGAAAGAAGAAAAATGGATAC
GTTACCAGAAACCAACGAATACCTTGGCAACCTGAATTTCAACTACCGAATTCAGGGCCATGCACGATTT
AAGCCGCTTCGGGTTTACAACAATGGCGTTAAGACCATTATTGAGATGCCGAAAACGATGGCACAAAGTG
AAGCCCCTGTTTTATTGGTTTTAAGAAGCCGTGGTTTGTTTCAAAAATCAGAGTCCGTCATGGTGAATTA
TCGTCTGCAAGGTTGTCGTTACATCGTCGATAGCGTTTTTGATAGGGCAATATTGGTTATCGGAAGTGGA
AGCTCTCAAGAAAAAATTACCATTACGAGGTGCTAA
 Primer design