SecReT4
Protein ID: 148360851
T4SS name [ID]Trb [80]
Gene symbol-
Locus tagLPC_2811
StrainLegionella pneumophila str. Corby
Repliconchromosome [GenBank: NC_009494] [Browse all T4SS(s) in this replicon]
Location [Strand]620323..620700 [+]
Producthypothetical protein
Component typeTrbC
UniProt IDA5IH62
KEGG IDlpc:LPC_2811
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 1.7e-18, Aligned region: 6..104
Protein Sequence: 125 a.a.     [Download]
>gi|148360851|ref|YP_001252058.1| hypothetical protein LPC_2811 [Legionella pneumophila str. Corby]
MNQLSSFNHKKIWMMGAVILFLFLMTHPASASTAGGGLPFDSWLTKIQKSITGPFAFSAAIIGLVAAGAT
LIFGGELNGFMRTLVFFVLVLSFLVAAQNTMTAITGKGAEISKPSVEMTAIESQP
 
Nucleotide Sequence: 378 bp     [Download]
>gi|295815281|ref|NC_009494.2|:620323-620700 Legionella pneumophila str. Corby chromosome, complete genome
ATGAATCAGTTAAGCAGTTTTAATCACAAGAAAATTTGGATGATGGGGGCAGTCATATTATTTCTATTTT
TAATGACTCATCCGGCTAGCGCCTCCACAGCAGGTGGAGGACTTCCATTCGACTCATGGTTAACCAAAAT
CCAGAAGTCCATTACAGGTCCATTTGCCTTTAGTGCGGCGATTATTGGTCTGGTTGCTGCCGGTGCCACA
CTTATTTTTGGTGGTGAATTAAATGGTTTTATGCGAACCCTTGTCTTTTTTGTATTGGTGCTTTCATTCC
TGGTAGCGGCACAAAATACCATGACAGCGATTACTGGCAAAGGGGCGGAAATTTCCAAGCCATCTGTTGA
GATGACAGCAATCGAGTCTCAGCCATGA
 Primer design