SecReT4
Protein ID: 148548139
T4SS name [ID]Tfc [744]
Gene symbol-
Locus tagPput_2929
StrainPseudomonas putida F1
Repliconchromosome [GenBank: NC_009512] [Browse all T4SS(s) in this replicon]
Location [Strand]3314704..3315219 [+]
Producthypothetical protein
Component typeTfc2
UniProt IDA5W4J7
KEGG IDppf:Pput_2929
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 171 a.a.     [Download]
>gi|148548139|ref|YP_001268241.1| unnamed protein product [Pseudomonas putida F1]
MHTPTLSTLGLMIALAGCSTPPPAPAPAPAAPPALPAALPKPKAQLPAWVRQDRYTLVTTRPTLEQRQPL
YQLVNVQIAPALHATVGEALRHLLQRSGYALCADSAAVDRLFRRPLPAVQHQFGPISLLDALTIIAGPAW
RLEIDPVDRTVCYALRVPSPAPPFSTLEIAP
 
Nucleotide Sequence: 516 bp     [Download]
>gi|148545259|ref|NC_009512.1|:3314704-3315219 Pseudomonas putida F1 chromosome, complete genome
ATGCACACACCCACACTCTCCACCCTCGGACTGATGATCGCCCTGGCGGGCTGTAGCACGCCGCCACCGG
CTCCGGCCCCGGCTCCCGCAGCGCCACCCGCGTTGCCGGCGGCATTGCCCAAGCCGAAAGCCCAGCTGCC
GGCCTGGGTGCGCCAGGACCGTTACACCCTGGTCACGACCCGGCCCACGCTGGAGCAGCGCCAGCCGCTG
TATCAATTGGTCAACGTACAAATTGCGCCAGCCCTGCATGCCACCGTCGGTGAAGCCCTGCGTCACCTGC
TGCAACGCTCAGGCTACGCGTTGTGTGCCGATAGCGCAGCGGTGGATCGCTTGTTCCGTCGCCCTCTGCC
TGCAGTACAGCACCAATTCGGCCCCATCTCACTGCTGGACGCCCTGACCATCATCGCCGGCCCGGCTTGG
CGACTCGAGATCGATCCAGTTGATCGGACCGTGTGCTATGCCCTGCGCGTGCCGTCGCCTGCACCTCCTT
TCTCGACACTGGAGATTGCGCCATGA
 Primer design