SecReT4
Protein ID: 148548141
T4SS name [ID]Tfc [744]
Gene symbol-
Locus tagPput_2931
StrainPseudomonas putida F1
Repliconchromosome [GenBank: NC_009512] [Browse all T4SS(s) in this replicon]
Location [Strand]3315898..3316617 [+]
Producthypothetical protein
Component typeTfc3
UniProt IDA5W4J9
KEGG IDppf:Pput_2931
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 239 a.a.     [Download]
>gi|148548141|ref|YP_001268243.1| unnamed protein product [Pseudomonas putida F1]
MARFSILSLVLVPGCLSAGVAWTAPKLVDSAPQFSEQTPLEWQASDATRAKAWGLTEDEWVKFEHLQAGP
RHYWSPQLDPLTTLGVEADSDQERQRYAELQVRLEAKRAERELAYQKAYTSAWARLFPEMLPVQGMADDP
AATPASRFALFVEERCPRCVINTQQWLHGGARLDVYLVGSQGDDGRLRQWAQGAGITPTQISSGQVTLNH
DRGRWFALGASRPLPARYQQMDGKWQRID
 
Nucleotide Sequence: 720 bp     [Download]
>gi|148545259|ref|NC_009512.1|:3315898-3316617 Pseudomonas putida F1 chromosome, complete genome
ATGGCTCGGTTCTCTATCCTCTCGCTTGTCCTGGTTCCCGGCTGCCTGTCCGCAGGAGTGGCGTGGACCG
CGCCAAAACTGGTCGACTCGGCCCCGCAGTTCAGCGAACAGACACCGCTGGAATGGCAGGCATCCGATGC
GACTCGGGCCAAGGCCTGGGGGCTGACGGAGGATGAGTGGGTTAAGTTCGAGCACCTGCAGGCTGGGCCC
CGCCACTATTGGTCGCCGCAGCTCGACCCACTCACCACCCTCGGGGTGGAAGCCGACTCGGACCAGGAAC
GGCAACGCTACGCCGAGCTGCAGGTCCGTCTCGAGGCCAAGCGCGCCGAGCGCGAACTGGCCTACCAGAA
GGCCTACACCTCCGCCTGGGCGCGGCTGTTCCCGGAAATGCTGCCCGTGCAGGGCATGGCCGATGATCCA
GCAGCCACCCCTGCTAGCCGCTTTGCCCTGTTTGTGGAAGAACGCTGCCCGCGCTGCGTCATCAACACTC
AGCAATGGCTGCATGGTGGCGCGCGCCTCGATGTGTACTTGGTCGGCAGCCAGGGTGACGATGGGCGTCT
CCGCCAGTGGGCACAGGGCGCGGGCATTACCCCCACCCAGATCAGCAGTGGCCAAGTCACTCTCAACCAT
GACCGTGGCCGCTGGTTCGCTCTGGGCGCCAGCCGCCCCTTACCGGCGCGCTACCAGCAGATGGACGGCA
AATGGCAGCGCATCGACTGA
 Primer design