SecReT4
Protein ID: 148548142
T4SS name [ID]Tfc [744]
Gene symbol-
Locus tagPput_2932
StrainPseudomonas putida F1
Repliconchromosome [GenBank: NC_009512] [Browse all T4SS(s) in this replicon]
Location [Strand]3316599..3317153 [+]
Productlytic transglycosylase subunit
Component typeTfc4
UniProt IDA5W4K0
KEGG IDppf:Pput_2932
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 184 a.a.     [Download]
>gi|148548142|ref|YP_001268244.1| unnamed protein product [Pseudomonas putida F1]
MAAHRLILALALACATAVHADALPPPAYQLAAARAGIPASVLFAIALQESGTPLRGHLMPWPWTLNVAGT
PQRFARRDEACAALKQALIRHDPKRIDVGLGQTNLGYHPDRYRSACEALDPRANLAVTAELLRAHYADSG
DWVVAAGRYHRPAGGKPAAQYRRQFSQHWQRVQALVASPRGPQP
 
Nucleotide Sequence: 555 bp     [Download]
>gi|148545259|ref|NC_009512.1|:3316599-3317153 Pseudomonas putida F1 chromosome, complete genome
ATGGCAGCGCATCGACTGATCCTCGCGCTGGCCTTGGCCTGCGCCACGGCCGTTCACGCCGACGCGCTGC
CGCCTCCGGCGTATCAACTGGCCGCCGCACGCGCCGGCATCCCTGCCTCCGTGCTGTTCGCCATCGCCCT
CCAAGAGAGCGGCACGCCGCTGCGAGGTCACCTCATGCCCTGGCCTTGGACCTTGAATGTTGCTGGTACG
CCGCAGCGTTTCGCCCGCCGTGATGAAGCGTGTGCCGCACTCAAACAGGCCTTGATCCGTCACGATCCCA
AGCGTATCGACGTCGGGCTGGGCCAGACCAACCTCGGCTACCACCCTGATCGGTACCGCAGCGCCTGCGA
AGCTCTGGATCCGCGCGCCAACTTGGCTGTGACTGCCGAGCTGCTACGCGCCCACTATGCCGACAGCGGT
GACTGGGTCGTGGCGGCGGGCCGCTATCATCGCCCTGCCGGCGGGAAGCCTGCAGCGCAGTACCGCCGCC
AGTTCAGCCAGCACTGGCAGCGTGTCCAAGCGCTCGTGGCATCTCCGAGAGGGCCGCAGCCATGA
 Primer design