SecReT4
Protein ID: 148548143
T4SS name [ID]Tfc [744]
Gene symbol-
Locus tagPput_2933
StrainPseudomonas putida F1
Repliconchromosome [GenBank: NC_009512] [Browse all T4SS(s) in this replicon]
Location [Strand]3317150..3317569 [+]
Producthypothetical protein
Component typeTfc5
UniProt IDA5W4K1
KEGG IDppf:Pput_2933
PDB IDNA
Domain hit(s) vs Pfam DUF2859 [PF11072], Evalue: 6.6e-44, Aligned region: 25..138
Protein Sequence: 139 a.a.     [Download]
>gi|148548143|ref|YP_001268245.1| unnamed protein product [Pseudomonas putida F1]
MNRRCWVTLCICLWWTVGTPAPPSQRPDPRALTWALPVHSTRLSPGAVSPRALSLPGFTPLFLVGHDVAS
LEWLAQHAQRLQDLGASGLAVEVADAPALRRIQAAAPGVDIWPVSGDDIAERLELQHYPVLITPTGLEQ
 
Nucleotide Sequence: 420 bp     [Download]
>gi|148545259|ref|NC_009512.1|:3317150-3317569 Pseudomonas putida F1 chromosome, complete genome
ATGAACCGTCGGTGCTGGGTAACGCTGTGTATTTGTCTGTGGTGGACGGTTGGCACGCCCGCGCCCCCCA
GCCAGCGGCCCGATCCCCGCGCGCTGACCTGGGCCCTGCCCGTACACAGCACACGCCTTTCACCCGGTGC
CGTGTCGCCAAGGGCATTGAGCCTGCCAGGGTTCACGCCACTGTTCCTGGTCGGGCACGACGTCGCCTCT
CTGGAATGGTTGGCCCAGCATGCACAGAGGCTGCAGGACCTGGGCGCCAGCGGCCTGGCGGTTGAAGTGG
CCGACGCCCCGGCGTTGCGCCGCATCCAGGCGGCAGCCCCTGGAGTGGACATCTGGCCGGTGAGCGGCGA
CGACATCGCCGAGCGCCTGGAACTGCAGCACTACCCGGTGCTGATCACGCCCACCGGCCTGGAACAGTGA
 Primer design