SecReT4
Protein ID: 148548144
T4SS name [ID]Tfc [744]
Gene symbol-
Locus tagPput_2934
StrainPseudomonas putida F1
Repliconchromosome [GenBank: NC_009512] [Browse all T4SS(s) in this replicon]
Location [Strand]3317579..3319705 [+]
Producthypothetical protein
Component typeTfc6
UniProt IDA5W4K2
KEGG IDppf:Pput_2934
PDB IDNA
Domain hit(s) vs Pfam TraG-D_C [PF12696], Evalue: 1.1e-16, Aligned region: 503..633
TrwB_AAD_bind [PF10412], Evalue: 9.4e-09, Aligned region: 504..640
AAA_10 [PF12846], Evalue: 3.4e-08, Aligned region: 189..580
Protein Sequence: 708 a.a.     [Download]
>gi|148548144|ref|YP_001268246.1| unnamed protein product [Pseudomonas putida F1]
MGEHAMESLLRPAVELYTVGICAGAGALCLHSPWAVALSPEVGAGMALAYTAFGLKRLNEARIVLRYRRN
IRRLPRYSLTSRQIPVSGKRLFMGRGFRWTRLHTQRLLEAQDPALARYVNQSAAHQWARRMEHLLEKAPP
GLSLLPRLTAWDSPFNPVRPLPPVGGSPLLHGVEPKEQEASLPLGERVGHTLVLGTTRVGKTRLAEVYIT
QDIHRPSQEVVIVFDPKGDADLLKRMYVEARRAGREHEFYVFHLGWPEISARYNAIGRFGRISEVASRIA
GQLSGEGNSAAFREFAWRFVNIIARALIELGRRPDYLQIQRHVVNIDALFIEYAQHFFARHDPQAWEAIV
QIEGRLNEKNIPRHMVGREKRVVAIEQYLSAKRIFDPVMDGLRSAVRYDRTYFDKIVASLLPLLEKLTSG
KTAQLLAPNYTDLDDPRPIFDWLQVIRKRGIVYVGLDALCDAEVAAAVGNSMFADLVSVAGHIYKHGIDH
GLPGSSSAADKVPINLHADEFNELMGDEFIPLINKGGGAGIQVTAYTQTLSDIEARIGNRAKAGQVIGNF
NTLQMLRVRETATAELLTNQLPKVNVQTRTLVSGATDTADPDARTDFTSSSQDRVTTTSVPLIEPAHIIA
LPKGQMFSFQEGGQLWKVRMPLPKPASDDAMPADLQTLAERMRDSYNANAGSWWSTTGGAPTVDFDPEQP
PPGRRHTP
 
Nucleotide Sequence: 2127 bp     [Download]
>gi|148545259|ref|NC_009512.1|:3317579-3319705 Pseudomonas putida F1 chromosome, complete genome
ATGGGCGAACATGCGATGGAGTCCCTGCTGCGCCCTGCGGTGGAGCTGTACACCGTGGGCATCTGCGCCG
GTGCCGGCGCCCTGTGTCTGCACTCACCTTGGGCGGTGGCGCTATCGCCAGAGGTGGGGGCAGGCATGGC
CCTGGCCTATACCGCATTCGGCCTGAAGCGGCTCAACGAGGCACGGATCGTCCTGCGCTATCGGCGCAAT
ATCCGCCGCCTGCCGCGCTACTCGCTGACCAGCCGACAGATTCCGGTGAGCGGCAAGCGCCTGTTCATGG
GCCGTGGCTTTCGCTGGACCCGCCTGCACACCCAGCGTCTGCTCGAGGCGCAGGACCCGGCGTTGGCCCG
CTACGTCAATCAGTCGGCCGCCCACCAGTGGGCGCGACGGATGGAACATCTGCTGGAGAAGGCCCCGCCA
GGGTTGTCGCTGTTGCCCCGCCTGACCGCCTGGGACAGCCCATTTAACCCGGTACGGCCCCTGCCGCCGG
TGGGCGGCTCGCCACTGCTGCACGGCGTCGAACCAAAGGAACAGGAAGCCAGCTTGCCGCTGGGCGAGCG
CGTCGGCCACACCCTGGTGCTGGGCACCACGCGAGTCGGCAAGACACGCTTGGCCGAGGTGTACATCACC
CAGGACATACACCGACCCAGCCAGGAAGTGGTGATCGTCTTCGACCCCAAGGGCGATGCCGACCTGCTCA
AGCGTATGTACGTGGAAGCGCGGCGCGCCGGCCGTGAGCATGAATTCTATGTGTTCCACCTGGGCTGGCC
GGAGATCTCCGCGCGCTACAACGCCATCGGCCGCTTCGGCCGCATCTCCGAAGTCGCCTCCCGCATCGCT
GGCCAACTGAGCGGCGAAGGCAATTCGGCCGCATTTCGCGAGTTCGCTTGGCGCTTTGTCAACATCATCG
CCCGGGCCCTGATCGAGCTCGGCCGGCGCCCCGACTACCTGCAAATCCAGCGGCATGTGGTGAACATCGA
TGCGCTGTTCATCGAGTACGCCCAGCACTTCTTCGCCCGCCATGATCCTCAGGCCTGGGAAGCGATCGTG
CAAATCGAAGGCCGGCTGAACGAGAAGAACATCCCGCGCCACATGGTTGGCCGGGAAAAGCGCGTGGTCG
CCATCGAGCAGTACCTGAGCGCCAAGCGCATCTTCGATCCGGTGATGGACGGCCTTCGCTCAGCCGTACG
CTACGACCGTACCTACTTCGACAAGATCGTGGCTTCACTGCTGCCACTCCTGGAAAAACTCACCAGCGGC
AAGACCGCACAACTGCTCGCCCCCAACTACACCGACCTCGACGATCCACGGCCGATCTTCGACTGGCTGC
AGGTCATCCGCAAACGCGGCATCGTCTACGTCGGCCTGGATGCGCTGTGCGATGCTGAGGTCGCCGCCGC
TGTCGGTAACTCGATGTTTGCCGACCTGGTCTCCGTCGCTGGCCATATCTACAAACACGGTATCGATCAT
GGCCTGCCAGGCTCCTCCAGCGCCGCGGACAAGGTGCCGATCAACCTGCACGCCGACGAGTTCAACGAAC
TGATGGGCGACGAGTTCATTCCACTGATCAACAAGGGTGGTGGCGCCGGTATCCAGGTCACCGCCTACAC
CCAGACCTTGAGCGACATTGAAGCGCGTATCGGCAACCGGGCCAAGGCCGGCCAGGTCATCGGCAACTTC
AACACCCTGCAGATGCTACGGGTACGGGAGACCGCCACCGCCGAACTGCTGACCAACCAACTGCCCAAGG
TCAACGTACAGACCCGCACCCTGGTCTCTGGCGCGACGGACACCGCCGATCCGGATGCCCGAACCGACTT
CACCTCCTCCTCGCAGGATCGGGTTACCACCACTTCGGTACCGCTGATCGAGCCGGCGCACATTATCGCC
TTGCCCAAGGGACAGATGTTCTCGTTCCAGGAAGGCGGACAATTGTGGAAGGTGCGCATGCCGCTACCGA
AGCCGGCCAGCGACGACGCAATGCCGGCAGACCTGCAGACCCTAGCAGAGCGCATGCGCGATTCCTACAA
CGCCAATGCGGGGAGTTGGTGGAGCACCACCGGCGGCGCTCCGACGGTCGATTTCGATCCAGAGCAGCCT
CCACCCGGGCGCAGACACACACCGTAA
 Primer design