SecReT4
Protein ID: 148548145
T4SS name [ID]Tfc [744]
Gene symbol-
Locus tagPput_2935
StrainPseudomonas putida F1
Repliconchromosome [GenBank: NC_009512] [Browse all T4SS(s) in this replicon]
Location [Strand]3319740..3320468 [+]
Producthypothetical protein
Component typeTfc8
UniProt IDA5W4K3
KEGG IDppf:Pput_2935
PDB IDNA
Domain hit(s) vs Pfam DUF4400 [PF14348], Evalue: 1.2e-63, Aligned region: 45..239
Protein Sequence: 242 a.a.     [Download]
>gi|148548145|ref|YP_001268247.1| unnamed protein product [Pseudomonas putida F1]
MPTTPASPPPPQRSSGLIFGTLELCLRLLGLLLASLIFSIALEFVGMLWFWPEQGWHHSHAMWLSELGWL
SNHFKNSLLVQEPAQATAKILEHLNDWAAVRSGWAQSDTQLKLLSREASFQGKFAQVYVVIQDYLLAALF
TVFTFVVRLAVLTLAMPLFLLAVVTGAVDGLMRRDLRKFGAGRESSFVYHRAKRTLLPLMVSPWVIYLSL
PLTVNPIWVLLPCAAVLGWMVAVTAATFKKYL
 
Nucleotide Sequence: 729 bp     [Download]
>gi|148545259|ref|NC_009512.1|:3319740-3320468 Pseudomonas putida F1 chromosome, complete genome
ATGCCTACGACCCCAGCCAGCCCACCACCTCCACAACGAAGTTCGGGGCTCATCTTCGGCACGCTCGAGC
TGTGTCTGCGGCTACTCGGCCTGCTGCTCGCTTCGCTGATTTTCTCAATCGCCCTGGAATTCGTGGGCAT
GCTGTGGTTCTGGCCCGAGCAGGGCTGGCATCACAGCCATGCGATGTGGCTGAGTGAGCTCGGCTGGCTC
AGTAATCACTTCAAGAACTCTTTGCTCGTGCAAGAGCCGGCGCAAGCGACCGCCAAGATACTCGAACACT
TGAACGACTGGGCCGCAGTGCGCTCTGGATGGGCGCAATCTGACACCCAGCTGAAACTGCTCAGTCGAGA
AGCGTCATTCCAGGGGAAGTTCGCGCAGGTCTATGTTGTGATACAGGACTACCTGCTGGCGGCTCTGTTC
ACGGTCTTTACTTTCGTAGTGCGGCTGGCCGTTCTCACACTGGCGATGCCGTTGTTCCTGCTTGCGGTGG
TCACCGGCGCCGTCGACGGCTTGATGCGTCGTGACCTCCGCAAGTTCGGGGCGGGTCGGGAGAGCAGCTT
TGTCTACCATCGAGCGAAGCGGACGTTGCTGCCGCTGATGGTAAGCCCTTGGGTGATCTACCTCTCCCTT
CCCTTAACGGTGAATCCCATTTGGGTCCTACTGCCATGCGCTGCAGTGCTTGGATGGATGGTTGCAGTCA
CGGCTGCGACTTTCAAAAAATACCTTTGA
 Primer design