SecReT4
Protein ID: 148548150
T4SS name [ID]Tfc [744]
Gene symbol-
Locus tagPput_2940
StrainPseudomonas putida F1
Repliconchromosome [GenBank: NC_009512] [Browse all T4SS(s) in this replicon]
Location [Strand]3323684..3324043 [+]
Producthypothetical protein
Component typeTfc9
UniProt IDA5W4K8
KEGG IDppf:Pput_2940
PDB IDNA
Domain hit(s) vs Pfam Plasmid_RAQPRD [PF09686], Evalue: 2.4e-30, Aligned region: 26..105
Protein Sequence: 119 a.a.     [Download]
>gi|148548150|ref|YP_001268252.1| unnamed protein product [Pseudomonas putida F1]
MPDTRLDFTMNASFALLLSCVVSLGAVAQDAPERSDLGLVQRQLKAIELLADRASSGSVDSAGARFRFDY
SRFAADLKLMRQGIQQYLSPSRAQPADLVELTGNYRAEAPHSSPNDEHD
 
Nucleotide Sequence: 360 bp     [Download]
>gi|148545259|ref|NC_009512.1|:3323684-3324043 Pseudomonas putida F1 chromosome, complete genome
ATGCCAGATACCCGTCTGGATTTCACCATGAACGCTTCTTTCGCCCTGTTACTTTCCTGTGTGGTGTCGC
TCGGTGCCGTCGCCCAAGACGCGCCGGAGCGCTCAGATCTCGGCCTAGTGCAGCGGCAGCTCAAAGCCAT
CGAACTGTTGGCCGACCGCGCAAGCAGCGGCTCAGTCGATTCCGCAGGGGCCCGCTTTCGCTTCGATTAT
TCGAGGTTCGCTGCGGACCTCAAGCTTATGCGTCAAGGCATCCAACAATACCTGTCACCTTCGCGTGCGC
AGCCAGCCGATCTGGTCGAGCTGACCGGTAATTACCGTGCTGAAGCGCCTCACTCGAGCCCAAACGATGA
GCATGACTGA
 Primer design